PDB entry 2xza

View 2xza on RCSB PDB site
Description: crystal structure of recombinant a.17 antibody fab fragment
Class: immune system
Keywords: immune system
Deposited on 2010-11-24, released 2011-09-21
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-10-05, with a file datestamp of 2011-09-30.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.16759
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: fab a.17 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2XZA (0-End)
  • Chain 'L':
    Compound: fab a.17 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2XZA (0-215)
    Domains in SCOPe 2.03: d2xzal1, d2xzal2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2xzaL (L:)
esvltqppsvsaapgqkvtiscsgsssnignnyvswyqqlpgtapklliydnnkrpsgip
drfsgsksgtsatlgitglqtgdeadyycgtwdsslnpvfgggtkleikrtvaapsvfif
ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
ltlskadyekhkvyacevthqglsspvtksfnrgec