PDB entry 2xyw

View 2xyw on RCSB PDB site
Description: novel sulfonylthiadiazoles with an unusual binding mode as partial dual peroxisome proliferator-activated receptor (ppar) gamma-delta agonists with high potency and in-vivo efficacy
Class: transcription
Keywords: DNA-binding, transcription, transcription regulation, receptor, activator, zinc-finger
Deposited on 2010-11-19, released 2011-02-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-05-25, with a file datestamp of 2011-05-20.
Experiment type: XRAY
Resolution: 3.14 Å
R-factor: 0.1906
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor delta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xywa_
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor delta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xywb_
  • Heterogens: 08S, BOG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xywA (A:)
    mkkghhhhhhggsqynpqvadlkafskhiynaylknfnmtkkkarsiltgkashtapfvi
    hdietlwqaekglvwkqlvnglppykeisvhvfyrcqcttvetvreltefaksipsfssl
    flndqvtllkygvheaifamlasivnkdgllvangsgfvtreflrslrkpfsdiiepkfe
    favkfnalelddsdlalfiaaiilcgdrpglmnvprveaiqdtilralefhlqanhpdaq
    ylfpkllqkmadlrqlvtehaqmmqrikktetetslhpllqeiykdmy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xywA (A:)
    dlkafskhiynaylknfnmtkkkarsiltgkapfvihdietlwqaekglvwkqlvnglpp
    ykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifamlasi
    vnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaaiil
    cgdrpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlvtehaqmm
    qrikktetetslhpllqeiykdm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2xywB (B:)
    mkkghhhhhhggsqynpqvadlkafskhiynaylknfnmtkkkarsiltgkashtapfvi
    hdietlwqaekglvwkqlvnglppykeisvhvfyrcqcttvetvreltefaksipsfssl
    flndqvtllkygvheaifamlasivnkdgllvangsgfvtreflrslrkpfsdiiepkfe
    favkfnalelddsdlalfiaaiilcgdrpglmnvprveaiqdtilralefhlqanhpdaq
    ylfpkllqkmadlrqlvtehaqmmqrikktetetslhpllqeiykdmy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xywB (B:)
    dlkafskhiynaylknfnmtkkkarsiltgkapfvihdietlwqaekglvwkqlvnglpp
    ykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifamlasi
    vnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaaiil
    cgdrpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlvtehaqmm
    qrikktetetslhpllqeiykdm