PDB entry 2xyv

View 2xyv on RCSB PDB site
Description: Crystal structure of the nsp16 nsp10 SARS coronavirus complex
Class: transferase/viral protein
Keywords: transferase-viral protein complex, rossmann fold
Deposited on 2010-11-19, released 2011-10-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: 0.20205
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative 2'-o-methyl transferase
    Species: SARS coronavirus [TaxId:227859]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: non-structural protein 10
    Species: SARS coronavirus [TaxId:227859]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C6X7
      • engineered mutation (86)
    Domains in SCOPe 2.07: d2xyvb_
  • Heterogens: NA, CL, SAH, MG, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2xyvB (B:)
    nstvlsfcafavdpakaykdylasggqpitncvkmlcthtgtgqaitvtpeanmdqesfg
    gascclycrchidhpnpkgfcdlkgkfvqipttcandpvgftlrntvctvcgmwkgygcs
    cd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xyvB (B:)
    stvlsfcafavdpakaykdylasggqpitncvkmlcthtgtgqaitvtpeanmdqesfgg
    ascclycrchidhpncdlkgkfvqipttcandpvgftlrntvctvcgmwkgygcs