PDB entry 2xyr

View 2xyr on RCSB PDB site
Description: crystal structure of the nsp16 nsp10 sars coronavirus complex
Class: transferase/viral protein
Keywords: transferase-viral protein complex, rossman fold
Deposited on 2010-11-18, released 2011-10-26
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-10-26, with a file datestamp of 2011-10-21.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.2026
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative 2'-o-methyl transferase
    Species: SARS coronavirus [TaxId:227859]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: non-structural protein 10
    Species: SARS coronavirus [TaxId:227859]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2xyrb_
  • Heterogens: NA, CL, SFG, MG, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2xyrB (B:)
nstvlsfcafavdpakaykdylasggqpitncvkmlcthtgtgqaitvtpeanmdqesfg
gascclycrchidhpnpkgfcdlkgkyvqipttcandpvgftlrntvctvcgmwkgygcs
cd

    Sequence, based on observed residues (ATOM records): (download) 
    >2xyrB (B:)
tvlsfcafavdpakaykdylasggqpitncvkmlcthtgtgqaitvtpeanmdqesfgga
scclycrchidhpncdlkgkyvqipttcandpvgftlrntvctvcgmwkgygcscd