PDB entry 2xyq

View 2xyq on RCSB PDB site
Description: Crystal structure of the nsp16 nsp10 SARS coronavirus complex
Class: transferase/viral protein
Keywords: transferase-viral protein complex, rossmann fold
Deposited on 2010-11-18, released 2011-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.21387
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative 2'-o-methyl transferase
    Species: SARS coronavirus [TaxId:227859]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: non-structural protein 10
    Species: SARS coronavirus [TaxId:227859]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2xyqb_
  • Heterogens: CL, SAH, NA, MG, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2xyqB (B:)
    nstvlsfcafavdpakaykdylasggqpitncvkmlcthtgtgqaitvtpeanmdqesfg
    gascclycrchidhpnpkgfcdlkgkyvqipttcandpvgftlrntvctvcgmwkgygcs
    cd