PDB entry 2xyj

View 2xyj on RCSB PDB site
Description: novel sulfonylthiadiazoles with an unusual binding mode as partial dual peroxisome proliferator-activated receptor (ppar) gamma-delta agonists with high potency and in-vivo efficacy
Class: transcription
Keywords: transcription
Deposited on 2010-11-18, released 2011-02-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-05-25, with a file datestamp of 2011-05-20.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.208
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor delta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xyja_
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor delta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xyjb_
  • Heterogens: WLM, 1PE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xyjA (A:)
    mkkghhhhhhggsqynpqvadlkafskhiynaylknfnmtkkkarsiltgkashtapfvi
    hdietlwqaekglvwkqlvnglppykeisvhvfyrcqcttvetvreltefaksipsfssl
    flndqvtllkygvheaifamlasivnkdgllvangsgfvtreflrslrkpfsdiiepkfe
    favkfnalelddsdlalfiaaiilcgdrpglmnvprveaiqdtilralefhlqanhpdaq
    ylfpkllqkmadlrqlvtehaqmmqrikktetetslhpllqeiykdmy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xyjA (A:)
    adlkafskhiynaylknfnmtkkkarsiltgshtapfvihdietlwqaekglvwkqglpp
    ykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifamlasi
    vnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaaiil
    cgdrpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlvtehaqmm
    qrikktetetslhpllqeiykdm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2xyjB (B:)
    mkkghhhhhhggsqynpqvadlkafskhiynaylknfnmtkkkarsiltgkashtapfvi
    hdietlwqaekglvwkqlvnglppykeisvhvfyrcqcttvetvreltefaksipsfssl
    flndqvtllkygvheaifamlasivnkdgllvangsgfvtreflrslrkpfsdiiepkfe
    favkfnalelddsdlalfiaaiilcgdrpglmnvprveaiqdtilralefhlqanhpdaq
    ylfpkllqkmadlrqlvtehaqmmqrikktetetslhpllqeiykdmy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xyjB (B:)
    adlkafskhiynaylknfnmtkkkarsiltgtapfvihdietlwqaekglvwglppykei
    svhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifamlasivnkd
    gllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaaiilcgdr
    pglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlvtehaqmmqrik
    ktetetslhpllqeiykdm