PDB entry 2xy4

View 2xy4 on RCSB PDB site
Description: x-ray structure of znua-wt from salmonella enterica
Class: metal transport
Keywords: metal transport
Deposited on 2010-11-15, released 2011-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-07-08.
Experiment type: XRAY
Resolution: 1.71 Å
R-factor: 0.21115
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: zinc abc transporter, periplasmic zinc-binding protein
    Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:90371]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2xy4a_
  • Heterogens: ZN, PGE, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xy4A (A:)
    avvaslkplgfiasaiadgvtdtqvllpdgasehdyslrpsdvkrlqgadlvvwvgpeme
    afmeksvrnipdnkqvtiaqladvkpllmkgadddedehahtgadeekgdvhhhhgeynm
    hlwlspeiaratavaiheklvelmpqsrakldanlkdfeaqlaatdkqvgnelaplkgkg
    yfvfhdaygyyekhygltplghftvnpeiqpgaqrlheirtqlveqkatcvfaepqfrpa
    vveavargtsvrmgtldplgtniklgktsysaflsqlanqyasclkgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xy4A (A:)
    avvaslkplgfiasaiadgvtdtqvllpdgasehdyslrpsdvkrlqgadlvvwvgpeme
    afmeksvrnipdnkqvtiaqladvkpllmkghhhgeynmhlwlspeiaratavaiheklv
    elmpqsrakldanlkdfeaqlaatdkqvgnelaplkgkgyfvfhdaygyyekhygltplg
    hftvnpeiqpgaqrlheirtqlveqkatcvfaepqfrpavveavargtsvrmgtldplgt
    niklgktsysaflsqlanqyasclkgd