PDB entry 2xxj

View 2xxj on RCSB PDB site
Description: penta mutant of lactate dehydrogenase from thermus thermophilus, ternary complex
Class: oxidoreductase
Keywords: oxidoreductase, hyperthermophile
Deposited on 2010-11-10, released 2010-11-24
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-08-03, with a file datestamp of 2011-07-29.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: 0.1777
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-lactate dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SJA1 (0-309)
      • engineered mutation (57)
      • engineered mutation (127)
      • engineered mutation (259)
      • engineered mutation (278)
      • engineered mutation (291)
    Domains in SCOPe 2.04: d2xxja1, d2xxja2
  • Chain 'B':
    Compound: l-lactate dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SJA1 (0-End)
      • engineered mutation (57)
      • engineered mutation (127)
      • engineered mutation (259)
      • engineered mutation (278)
      • engineered mutation (291)
    Domains in SCOPe 2.04: d2xxjb1, d2xxjb2
  • Chain 'C':
    Compound: l-lactate dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SJA1 (0-309)
      • engineered mutation (57)
      • engineered mutation (127)
      • engineered mutation (259)
      • engineered mutation (278)
      • engineered mutation (291)
    Domains in SCOPe 2.04: d2xxjc1, d2xxjc2
  • Chain 'D':
    Compound: l-lactate dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SJA1 (0-309)
      • engineered mutation (57)
      • engineered mutation (127)
      • engineered mutation (259)
      • engineered mutation (278)
      • engineered mutation (291)
    Domains in SCOPe 2.04: d2xxjd1, d2xxjd2
  • Heterogens: SO4, OXM, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2xxjA (A:)
    mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvwag
    sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
    vmtqvayalsglppgrvvgsgtildtarfrallaeylrvapqsvhayvlgehgdsevlvw
    ssaqvggvpllefaeargralspedraridegvrraayriiegkgatyygigaglarlvr
    ailtdekgvytvsaftpevagvlevslslprilgaggvagtvypslspeeraalrrsaei
    lkeaafalgf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2xxjB (B:)
    mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvwag
    sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
    vmtqvayalsglppgrvvgsgtildtarfrallaeylrvapqsvhayvlgehgdsevlvw
    ssaqvggvpllefaeargralspedraridegvrraayriiegkgatyygigaglarlvr
    ailtdekgvytvsaftpevagvlevslslprilgaggvagtvypslspeeraalrrsaei
    lkeaafalgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xxjB (B:)
    mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvwag
    sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
    vmtqvayalsglppgrvvgsgtildtarfrallaeylrvapqsvhayvlgehgdsevlvw
    ssaqvggvpllefaeargralspedraridegvrraayriiegkgatyygigaglarlvr
    ailtdekgvytvsaftpevagvlevslslprilgaggvagtvypslspeeraalrrsaei
    lkeaafalg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2xxjC (C:)
    mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvwag
    sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
    vmtqvayalsglppgrvvgsgtildtarfrallaeylrvapqsvhayvlgehgdsevlvw
    ssaqvggvpllefaeargralspedraridegvrraayriiegkgatyygigaglarlvr
    ailtdekgvytvsaftpevagvlevslslprilgaggvagtvypslspeeraalrrsaei
    lkeaafalgf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2xxjD (D:)
    mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvwag
    sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
    vmtqvayalsglppgrvvgsgtildtarfrallaeylrvapqsvhayvlgehgdsevlvw
    ssaqvggvpllefaeargralspedraridegvrraayriiegkgatyygigaglarlvr
    ailtdekgvytvsaftpevagvlevslslprilgaggvagtvypslspeeraalrrsaei
    lkeaafalgf