PDB entry 2xxb

View 2xxb on RCSB PDB site
Description: penta-mutant of thermus thermophilus lactate dehydrogenase, complex with amp
Class: oxidoreductase
Keywords: oxidoreductase, hyperthermophile
Deposited on 2010-11-09, released 2010-11-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-11-17, with a file datestamp of 2010-11-12.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.2227
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-lactate dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SJA1 (0-309)
      • engineered mutation (57)
      • engineered mutation (127)
      • engineered mutation (259)
      • engineered mutation (278)
      • engineered mutation (291)
    Domains in SCOPe 2.07: d2xxba1, d2xxba2
  • Chain 'B':
    Compound: l-lactate dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SJA1 (0-309)
      • engineered mutation (57)
      • engineered mutation (127)
      • engineered mutation (259)
      • engineered mutation (278)
      • engineered mutation (291)
    Domains in SCOPe 2.07: d2xxbb1, d2xxbb2
  • Heterogens: AMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2xxbA (A:)
    mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvwag
    sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
    vmtqvayalsglppgrvvgsgtildtarfrallaeylrvapqsvhayvlgehgdsevlvw
    ssaqvggvpllefaeargralspedraridegvrraayriiegkgatyygigaglarlvr
    ailtdekgvytvsaftpevagvlevslslprilgaggvagtvypslspeeraalrrsaei
    lkeaafalgf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2xxbB (B:)
    mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvwag
    sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
    vmtqvayalsglppgrvvgsgtildtarfrallaeylrvapqsvhayvlgehgdsevlvw
    ssaqvggvpllefaeargralspedraridegvrraayriiegkgatyygigaglarlvr
    ailtdekgvytvsaftpevagvlevslslprilgaggvagtvypslspeeraalrrsaei
    lkeaafalgf