PDB entry 2xvp

View 2xvp on RCSB PDB site
Description: chia1 from aspergillus fumigatus, apostructure
Class: hydrolase
Keywords: hydrolase, gh18, tim barrel, aspergillosis
Deposited on 2010-10-27, released 2011-06-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-06-01, with a file datestamp of 2011-05-27.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.20356
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: class III chitinase chia1
    Species: ASPERGILLUS FUMIGATUS [TaxId:451804]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0Y2Y2 (1-309)
      • expression tag (0)
    Domains in SCOPe 2.06: d2xvpa1, d2xvpa2
  • Chain 'B':
    Compound: class III chitinase chia1
    Species: ASPERGILLUS FUMIGATUS [TaxId:451804]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0Y2Y2 (1-309)
      • expression tag (0)
    Domains in SCOPe 2.06: d2xvpb1, d2xvpb2
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2xvpA (A:)
    fsnlaiywgqgpnqlrlshfcqetsldiinigfinyfpdmspghwpgsnfgnqcdgsvyv
    tndgvvtkllsgchqimedipicqaagkkvllsiggayppdqsilsedsavafatflwga
    fgpvaegwegprpfgdvvvdgfdfdiehnggfgyatmvntfrqyfnqvperkfylsaapq
    ciipdaqlsdaifnaafdfiwiqyyntaacsaksfidtslgtfnfdawvtvlkasaskda
    klyvglpasetaanqgyyltpdeveslvstymdrypdtfggimlweatasennqidgapy
    adhmkdillh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2xvpB (B:)
    fsnlaiywgqgpnqlrlshfcqetsldiinigfinyfpdmspghwpgsnfgnqcdgsvyv
    tndgvvtkllsgchqimedipicqaagkkvllsiggayppdqsilsedsavafatflwga
    fgpvaegwegprpfgdvvvdgfdfdiehnggfgyatmvntfrqyfnqvperkfylsaapq
    ciipdaqlsdaifnaafdfiwiqyyntaacsaksfidtslgtfnfdawvtvlkasaskda
    klyvglpasetaanqgyyltpdeveslvstymdrypdtfggimlweatasennqidgapy
    adhmkdillh