PDB entry 2xvn

View 2xvn on RCSB PDB site
Description: a. fumigatus chitinase a1 phenyl-methylguanylurea complex
Class: hydrolase
Keywords: hydrolase, inhibitor
Deposited on 2010-10-26, released 2010-11-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-06-01, with a file datestamp of 2011-05-27.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.25936
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aspergillus fumigatus chitinase a1
    Species: Aspergillus fumigatus [TaxId:5085]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xvna_
  • Chain 'B':
    Compound: aspergillus fumigatus chitinase a1
    Species: Aspergillus fumigatus [TaxId:5085]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xvnb_
  • Chain 'C':
    Compound: aspergillus fumigatus chitinase a1
    Species: Aspergillus fumigatus [TaxId:5085]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xvnc_
  • Heterogens: KLS, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2xvnA (A:)
    snlaiywgqgpnqlrlshfcqetsldiinigfinyfpdmspghwpgsnfgnqcdgsvyvt
    ndgvvtkllsgchqimedipicqaagkkvllsiggayppdqsilsedsavafatflwgaf
    gpvaegwegprpfgdvvvdgfdfdiehnggfgyatmvntfrqyfnqvperkfylsaapqc
    iipdaqlsdaifnaafdfiwiqyyntaacsaksfidtslgtfnfdawvtvlkasaskdak
    lyvglpasetaanqgyyltpdeveslvstymdrypdtfggimlweatasennqidgapya
    dhmkdillh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2xvnB (B:)
    snlaiywgqgpnqlrlshfcqetsldiinigfinyfpdmspghwpgsnfgnqcdgsvyvt
    ndgvvtkllsgchqimedipicqaagkkvllsiggayppdqsilsedsavafatflwgaf
    gpvaegwegprpfgdvvvdgfdfdiehnggfgyatmvntfrqyfnqvperkfylsaapqc
    iipdaqlsdaifnaafdfiwiqyyntaacsaksfidtslgtfnfdawvtvlkasaskdak
    lyvglpasetaanqgyyltpdeveslvstymdrypdtfggimlweatasennqidgapya
    dhmkdillh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2xvnC (C:)
    snlaiywgqgpnqlrlshfcqetsldiinigfinyfpdmspghwpgsnfgnqcdgsvyvt
    ndgvvtkllsgchqimedipicqaagkkvllsiggayppdqsilsedsavafatflwgaf
    gpvaegwegprpfgdvvvdgfdfdiehnggfgyatmvntfrqyfnqvperkfylsaapqc
    iipdaqlsdaifnaafdfiwiqyyntaacsaksfidtslgtfnfdawvtvlkasaskdak
    lyvglpasetaanqgyyltpdeveslvstymdrypdtfggimlweatasennqidgapya
    dhmkdillh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xvnC (C:)
    snlaiywgqlrlshfcqetsldiinifinsqimedipicqaagkkvllsiggdqsilsev
    afaflwgafgfgdvvvdgfdfdiegfgyatmvntfrrkfylsaapqciipdaqlsdaifn
    aafdfiwiqyynaacsksfgtnfdawvtvlksaskdaklyvglasetyyltpdeveslvs
    tymdypdtfggimlwesennqipyadhmkd