PDB entry 2xvm

View 2xvm on RCSB PDB site
Description: crystal structure of the tellurite detoxification protein tehb from e. coli in complex with sah
Class: transferase
Keywords: antibiotic resistance, transferase
Deposited on 2010-10-26, released 2011-02-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-04-06, with a file datestamp of 2011-04-01.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: 0.17337
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tellurite resistance protein tehb
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25397 (2-198)
      • expression tag (1)
      • engineered mutation (3)
    Domains in SCOPe 2.07: d2xvma1, d2xvma2
  • Chain 'B':
    Compound: tellurite resistance protein tehb
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2xvmb_
  • Heterogens: SAH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xvmA (A:)
    gamvirdenyftdkyeltrthsevleavkvvkpgktldlgcgngrnslylaangydvdaw
    dknamsianveriksienldnlhtrvvdlnnltfdrqydfilstvvlmfleaktipglia
    nmqrctkpggynlivaamdtadypctvgfpfafkegelrryyegwervkynedvgelhrt
    dangnriklrfatmlarkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xvmA (A:)
    amvirdenyftdkyeltrthsevleavkvvkpgktldlgcgngrnslylaangydvdawd
    knamsianveriksienldnlhtrvvdlnnltfdrqydfilstvvlmfleaktipglian
    mqrctkpggynlivaamdtadypctvgfpfafkegelrryyegwervkynedvgelhrtd
    angnriklrfatmlarkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2xvmB (B:)
    gamvirdenyftdkyeltrthsevleavkvvkpgktldlgcgngrnslylaangydvdaw
    dknamsianveriksienldnlhtrvvdlnnltfdrqydfilstvvlmfleaktipglia
    nmqrctkpggynlivaamdtadypctvgfpfafkegelrryyegwervkynedvgelhrt
    dangnriklrfatmlarkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xvmB (B:)
    rdenyftdkyeltrthsevleavkvvkpgktldlgcgngrnslylaangydvdawdknam
    sianveriksienldnlhtrvvdlnnltfdrqydfilstvvlmfleaktipglianmqrc
    tkpggynlivaamdtadypctvgfpfafkegelrryyegwervkynedvgelhrtdangn
    riklrfatmlarkk