PDB entry 2xua

View 2xua on RCSB PDB site
Description: crystal structure of the enol-lactonase from burkholderia xenovorans lb400
Class: hydrolase
Keywords: hydrolase, catechol metabolism
Deposited on 2010-10-17, released 2011-01-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-04-06, with a file datestamp of 2011-04-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.18542
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoadipate enol-lactonase
    Species: BURKHOLDERIA XENOVORANS [TaxId:266265]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xuaa_
  • Chain 'H':
    Compound: 3-oxoadipate enol-lactonase
    Species: BURKHOLDERIA XENOVORANS [TaxId:266265]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xuah_
  • Heterogens: SHF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xuaA (A:)
    gshmpyaavngtelhyridgerhgnapwivlsnslgtdlsmwapqvaalskhfrvlrydt
    rghghseapkgpytieqltgdvlglmdtlkiaranfcglsmggltgvalaarhadrierv
    alcntaarigspevwvpravkartegmhaladavlprwftadymerepvvlamirdvfvh
    tdkegyasnceaidaadlrpeapgikvpalvisgthdlaatpaqgrelaqaiagaryvel
    dashisnieradaftktvvdflteqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xuaA (A:)
    pyaavngtelhyridgerhgnapwivlsnslgtdlsmwapqvaalskhfrvlrydtrghg
    hseapkgpytieqltgdvlglmdtlkiaranfcglsmggltgvalaarhadriervalcn
    taarigspevwvpravkartegmhaladavlprwftadymerepvvlamirdvfvhtdke
    gyasnceaidaadlrpeapgikvpalvisgthdlaatpaqgrelaqaiagaryveldash
    isnieradaftktvvdflte
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2xuaH (H:)
    gshmpyaavngtelhyridgerhgnapwivlsnslgtdlsmwapqvaalskhfrvlrydt
    rghghseapkgpytieqltgdvlglmdtlkiaranfcglsmggltgvalaarhadrierv
    alcntaarigspevwvpravkartegmhaladavlprwftadymerepvvlamirdvfvh
    tdkegyasnceaidaadlrpeapgikvpalvisgthdlaatpaqgrelaqaiagaryvel
    dashisnieradaftktvvdflteqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xuaH (H:)
    mpyaavngtelhyridgerhgnapwivlsnslgtdlsmwapqvaalskhfrvlrydtrgh
    ghseapkgpytieqltgdvlglmdtlkiaranfcglsmggltgvalaarhadriervalc
    ntaarigspevwvpravkartegmhaladavlprwftadymerepvvlamirdvfvhtdk
    egyasnceaidaadlrpeapgikvpalvisgthdlaatpaqgrelaqaiagaryveldas
    hisnieradaftktvvdflte