PDB entry 2xu3

View 2xu3 on RCSB PDB site
Description: cathepsin l with a nitrile inhibitor
Class: hydrolase
Keywords: hydrolase, drug design, thiol protease
Deposited on 2010-10-14, released 2011-01-12
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-01-12, with a file datestamp of 2011-01-07.
Experiment type: XRAY
Resolution: 0.9 Å
R-factor: 0.14248
AEROSPACI score: 1.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cathepsin L1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2xu3a_
  • Heterogens: XU3, BTB, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2xu3A (A:)
aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestesdnn
kywlvknswgeewgmggyvkmakdrrnhcgiasaasyptv