PDB entry 2xtk

View 2xtk on RCSB PDB site
Description: ChiA1 from Aspergillus fumigatus in complex with acetazolamide
Class: hydrolase
Keywords: hydrolase, gh18
Deposited on 2010-10-11, released 2011-10-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-08-29, with a file datestamp of 2012-08-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.21752
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: class III chitinase chia1
    Species: ASPERGILLUS FUMIGATUS [TaxId:451804]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0Y2Y2 (1-309)
      • cloning artifact (0)
    Domains in SCOPe 2.06: d2xtka1, d2xtka2
  • Chain 'B':
    Compound: class III chitinase chia1
    Species: ASPERGILLUS FUMIGATUS [TaxId:451804]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xtkb_
  • Heterogens: AZM, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2xtkA (A:)
    fsnlaiywgqgpnqlrlshfcqetsldiinigfinyfpdmspghwpgsnfgnqcdgsvyv
    tndgvvtkllsgchqimedipicqaagkkvllsiggayppdqsilsedsavafatflwga
    fgpvaegwegprpfgdvvvdgfdfdiehnggfgyatmvntfrqyfnqvperkfylsaapq
    ciipdaqlsdaifnaafdfiwiqyyntaacsaksfidtslgtfnfdawvtvlkasaskda
    klyvglpasetaanqgyyltpdeveslvstymdrypdtfggimlweatasennqidgapy
    adhmkdillh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2xtkB (B:)
    fsnlaiywgqgpnqlrlshfcqetsldiinigfinyfpdmspghwpgsnfgnqcdgsvyv
    tndgvvtkllsgchqimedipicqaagkkvllsiggayppdqsilsedsavafatflwga
    fgpvaegwegprpfgdvvvdgfdfdiehnggfgyatmvntfrqyfnqvperkfylsaapq
    ciipdaqlsdaifnaafdfiwiqyyntaacsaksfidtslgtfnfdawvtvlkasaskda
    klyvglpasetaanqgyyltpdeveslvstymdrypdtfggimlweatasennqidgapy
    adhmkdillh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xtkB (B:)
    snlaiywgqgpnqlrlshfcqetsldiinigfinyfpdmspghwpgsnfgnqcdgsvyvt
    ndgvvtkllsgchqimedipicqaagkkvllsiggayppdqsilsedsavafatflwgaf
    gpvaegwegprpfgdvvvdgfdfdiehnggfgyatmvntfrqyfnqvperkfylsaapqc
    iipdaqlsdaifnaafdfiwiqyyntaacsaksfidtslgtfnfdawvtvlkasaskdak
    lyvglpasetaanqgyyltpdeveslvstymdrypdtfggimlweatasennqidgapya
    dhmkdillh