PDB entry 2xsx

View 2xsx on RCSB PDB site
Description: Crystal structure of human beta enolase ENOB
Class: lyase
Keywords: lyase
Deposited on 2010-09-30, released 2010-11-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-12-05, with a file datestamp of 2012-11-30.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.15463
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-enolase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2xsxa1, d2xsxa2
  • Chain 'B':
    Compound: beta-enolase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13929 (1-434)
      • expression tag (0)
    Domains in SCOPe 2.07: d2xsxb1, d2xsxb2, d2xsxb3
  • Heterogens: MG, PO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xsxA (A:)
    smamqkifareildsrgnptvevdlhtakgrfraavpsgastgiyealelrdgdkgrylg
    kgvlkaveninstlgpallqkklsvadqekvdkfmieldgtenkskfganailgvslavc
    kagaaekgvplyrhiadlagnpdlilpvpafnvinggshagnklamqefmilpvgassfk
    eamrigaevyhhlkgvikakygkdatnvgdeggfapnilennealellktaiqaagypdk
    vvigmdvaasefyrngkydldfkspddparhitgeklgelyksfiknypvvsiedpfdqd
    dwatwtsflsgvniqivgddltvtnpkriaqavekkacnclllkvnqigsvtesiqackl
    aqsngwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqlmrieealgd
    kaifagrkfrnpkak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xsxA (A:)
    mamqkifareildsrgnptvevdlhtakgrfraavpsgastgiyealelrdgdkgrylgk
    gvlkaveninstlgpallqkklsvadqekvdkfmieldgtenkskfganailgvslavck
    agaaekgvplyrhiadlagnpdlilpvpafnvinggshagnklamqefmilpvgassfke
    amrigaevyhhlkgvikakygkdatnvgdeggfapnilennealellktaiqaagypdkv
    vigmdvaasefyrngkydldfkspddparhitgeklgelyksfiknypvvsiedpfdqdd
    watwtsflsgvniqivgddltvtnpkriaqavekkacnclllkvnqigsvtesiqackla
    qsngwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqlmrieealgdk
    aifagrkfrnpkak
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2xsxB (B:)
    smamqkifareildsrgnptvevdlhtakgrfraavpsgastgiyealelrdgdkgrylg
    kgvlkaveninstlgpallqkklsvadqekvdkfmieldgtenkskfganailgvslavc
    kagaaekgvplyrhiadlagnpdlilpvpafnvinggshagnklamqefmilpvgassfk
    eamrigaevyhhlkgvikakygkdatnvgdeggfapnilennealellktaiqaagypdk
    vvigmdvaasefyrngkydldfkspddparhitgeklgelyksfiknypvvsiedpfdqd
    dwatwtsflsgvniqivgddltvtnpkriaqavekkacnclllkvnqigsvtesiqackl
    aqsngwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqlmrieealgd
    kaifagrkfrnpkak