PDB entry 2xsf

View 2xsf on RCSB PDB site
Description: crystal structure of the rrm domain of mouse deleted in azoospermia-like
Class: RNA binding protein
Keywords: RNA binding protein
Deposited on 2010-09-28, released 2011-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-23, with a file datestamp of 2011-11-18.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.189
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deleted in azoospermia-like
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2xsfa_
  • Heterogens: GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xsfA (A:)
    gplgsgkimpntvfvggidvrmdeteirsffarygsvkevkiitdrtgvskgygfvsfyn
    dvdvqkivesqinfhgkklklgpairkqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xsfA (A:)
    gkimpntvfvggidvrmdeteirsffarygsvkevkiitdrtgvskgygfvsfyndvdvq
    kivesqinfhgkklklgpair