PDB entry 2xrf

View 2xrf on RCSB PDB site
Description: Crystal structure of human uridine phosphorylase 2
Class: transferase
Keywords: transferase
Deposited on 2010-09-14, released 2010-09-29
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-11-27, with a file datestamp of 2013-11-22.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.1697
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uridine phosphorylase 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2xrfa_
  • Chain 'B':
    Compound: uridine phosphorylase 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2xrfb_
  • Chain 'C':
    Compound: uridine phosphorylase 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2xrfc_
  • Heterogens: MG, URA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xrfA (A:)
    mrfvhvknpyldlmdedilyhldlgtkthnlpamfgdvkfvcvggspnrmkafalfmhke
    lgfeeaeedikdicagtdrycmyktgpvlaishgmgipsisimlhelikllhharccdvt
    iirigtsggigiapgtvvitdiavdsffkprfeqvildnivtrsteldkelseelfncsk
    eipnfptlvghtmctydfyegqgrldgalcsfsrekkldylkrafkagvrniemestvfa
    amcglcglkaavvcvtlldrldcdqinlphdvlveyqqrpqllisnfirrrlglcdahhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xrfA (A:)
    rfvhvknpyldlmdedilyhldlgtkthnlpamfgdvkfvcvggspnrmkafalfmhkel
    gfedikdicagtdrycmyktgpvlaishgmgipsisimlhelikllhharccdvtiirig
    tsggigiapgtvvitdiavdsffkprfeqvildnivtrsteldkelseelfncskeipnf
    ptlvghtmctydfyegqgrldgalcsfsrekkldylkrafkagvrniemestvfaamcgl
    cglkaavvcvtlldrldcdqinlphdvlveyqqrpqllisnfirrrlgl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2xrfB (B:)
    mrfvhvknpyldlmdedilyhldlgtkthnlpamfgdvkfvcvggspnrmkafalfmhke
    lgfeeaeedikdicagtdrycmyktgpvlaishgmgipsisimlhelikllhharccdvt
    iirigtsggigiapgtvvitdiavdsffkprfeqvildnivtrsteldkelseelfncsk
    eipnfptlvghtmctydfyegqgrldgalcsfsrekkldylkrafkagvrniemestvfa
    amcglcglkaavvcvtlldrldcdqinlphdvlveyqqrpqllisnfirrrlglcdahhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xrfB (B:)
    rfvhvknpyldlmdedilyhldlgtkthnlpamfgdvkfvcvggspnrmkafalfmhkel
    gfeikdicagtdrycmyktgpvlaishgmgipsisimlhelikllhharccdvtiirigt
    sggigiapgtvvitdiavdsffkprfeqvildnivtrsteldkelseelfncskeipnfp
    tlvghtmctydfyegqgrldgalcsfsrekkldylkrafkagvrniemestvfaamcglc
    glkaavvcvtlldrldcdqinlphdvlveyqqrpqllisnfirrrlgl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2xrfC (C:)
    mrfvhvknpyldlmdedilyhldlgtkthnlpamfgdvkfvcvggspnrmkafalfmhke
    lgfeeaeedikdicagtdrycmyktgpvlaishgmgipsisimlhelikllhharccdvt
    iirigtsggigiapgtvvitdiavdsffkprfeqvildnivtrsteldkelseelfncsk
    eipnfptlvghtmctydfyegqgrldgalcsfsrekkldylkrafkagvrniemestvfa
    amcglcglkaavvcvtlldrldcdqinlphdvlveyqqrpqllisnfirrrlglcdahhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xrfC (C:)
    rfvhvknpyldlmdedilyhldlgtkthnlpamfgdvkfvcvggspnrmkafalfmhkel
    gfkdicagtdrycmyktgpvlaishgmgipsisimlhelikllhharccdvtiirigtsg
    gigiapgtvvitdiavdsffkprfeqvildnivtrsteldkelseelfncskeipnfptl
    vghtmctydfyegqgrldgalcsfsrekkldylkrafkagvrniemestvfaamcglcgl
    kaavvcvtlldrldcdqinlphdvlveyqqrpqllisnfirrrlgl