PDB entry 2xr5

View 2xr5 on RCSB PDB site
Description: Crystal structure of the complex of the carbohydrate recognition domain of human DC-SIGN with pseudo dimannoside mimic.
Class: sugar binding protein
Keywords: sugar binding protein
Deposited on 2010-09-10, released 2011-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-12-25, with a file datestamp of 2013-12-20.
Experiment type: XRAY
Resolution: 1.42 Å
R-factor: 0.14954
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CD209 antigen
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2xr5a_
  • Heterogens: MAN, 07B, ETA, CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xr5A (A:)
    maswshpqfekiegrhpcpwewtffqgncyfmsnsqrnwhdsitackevgaqlvviksae
    eqnflqlqssrsnrftwmglsdlnqegtwqwvdgspllpsfkqywnrgepnnvgeedcae
    fsgngwnddkcnlakfwickksaascsrdeeqflspapatpnpppa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xr5A (A:)
    hpcpwewtffqgncyfmsnsqrnwhdsitackevgaqlvviksaeeqnflqlqssrsnrf
    twmglsdlnqegtwqwvdgspllpsfkqywnrgepnnvgeedcaefsgngwnddkcnlak
    fwickksaasc