PDB entry 2xqz

View 2xqz on RCSB PDB site
Description: neutron structure of the perdeuterated toho-1 r274n r276n double mutant beta-lactamase
Class: hydrolase
Keywords: hydrolase, extended-spectrum beta-lactamases (esbls), ctx-m-type esbls
Deposited on 2010-09-08, released 2010-12-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-02-16, with a file datestamp of 2011-02-11.
Experiment type: NEUT
Resolution: 2.1 Å
R-factor: 0.2275
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-lactamse toho-1
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q47066 (0-259)
      • engineered mutation (243)
      • engineered mutation (245)
    Domains in SCOPe 2.05: d2xqza_
  • Heterogens: DOD

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2xqzA (A:)
    svqqqlealekssggrlgvalintadnsqilyraderfamcstskvmaaaavlkqsesdk
    hllnqrveikksdlvnynpiaekhvngtmtlaelgaaalqysdntamnkliahlggpdkv
    tafarslgdetfrldrteptlntaipgdprdtttplamaqtlknltlgkalaetqraqlv
    twlkgnttgsasiraglpkswvvgdktgsgdygttndiaviwpenhaplvlvtyftqpeq
    kaenrndilaaaakivthgf