PDB entry 2xqv

View 2xqv on RCSB PDB site
Description: the x-ray structure of the zn(II) bound znua from salmonella enterica
Class: metal transport
Keywords: metal transport
Deposited on 2010-09-07, released 2011-04-27
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-08-31, with a file datestamp of 2011-08-26.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.20679
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: zinc abc transporter, periplasmic zinc-binding protein
    Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:90371]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2xqva_
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xqvA (A:)
    avvaslkplgfiasaiadgvtdtqvllpdgasehdyslrpsdvkrlqgadlvvwvgpeme
    afmeksvrnipdnkqvtiaqladvkpllmkgadddedehahtgadeekgdvhhhhgeynm
    hlwlspeiaratavaiheklvelmpqsrakldanlkdfeaqlaatdkqvgnelaplkgkg
    yfvfhdaygyyekhygltplghftvnpeiqpgaqrlheirtqlveqkatcvfaepqfrpa
    vveavargtsvrmgtldplgtniklgktsysaflsqlanqyasclkgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xqvA (A:)
    avvaslkplgfiasaiadgvtdtqvllpdgasehdyslrpsdvkrlqgadlvvwvgpeme
    afmeksvrnipdnkqvtiaqladvkpllmkghhgeynmhlwlspeiaratavaiheklve
    lmpqsrakldanlkdfeaqlaatdkqvgnelaplkgkgyfvfhdaygyyekhygltplgh
    ftvnpeiqpgaqrlheirtqlveqkatcvfaepqfrpavveavargtsvrmgtldplgtn
    iklgktsysaflsqlanqyasclkg