PDB entry 2xpw

View 2xpw on RCSB PDB site
Description: tetr(d) in complex with oxytetracycline and magnesium.
Class: transcription
Keywords: transcription, transcription regulator, helix-turn-helix, metal coordination
Deposited on 2010-08-30, released 2011-09-07
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-09-07, with a file datestamp of 2011-09-02.
Experiment type: XRAY
Resolution: 1.44 Å
R-factor: 0.17789
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tetracycline repressor protein class d
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACT4 (0-206)
      • cloning artifact (0)
    Domains in SCOPe 2.03: d2xpwa1, d2xpwa2
  • Heterogens: OTC, MG, CL, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2xpwA (A:)
    srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
    rhhdyslpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmt
    engfslrdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsdd
    geqaflhgleslirgfevqltallqiv