PDB entry 2xoi

View 2xoi on RCSB PDB site
Description: functional and structural analyses of n-acylsulfonamide-linked dinucleoside inhibitors of ribonuclease a
Class: hydrolase
Keywords: hydrolase
Deposited on 2010-08-17, released 2011-01-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-01-26, with a file datestamp of 2011-01-21.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: 0.21693
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease pancreatic
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2xoia_
  • Chain 'B':
    Compound: ribonuclease pancreatic
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2xoib_
  • Heterogens: SFB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xoiA (A:)
    ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
    knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
    dasv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xoiA (A:)
    etaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsqk
    nvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhfd
    asv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2xoiB (B:)
    ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
    knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
    dasv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xoiB (B:)
    ketaaakferqhmdsstssssnycnqmmksrnltkdrckpvntfvhesladvqavcsqkn
    vackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhfda
    sv