PDB entry 2xog

View 2xog on RCSB PDB site
Description: functional and structural analyses of n-acylsulfonamide-linked dinucleoside inhibitors of ribonuclease a
Class: hydrolase
Keywords: hydrolase
Deposited on 2010-08-16, released 2011-01-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-01-26, with a file datestamp of 2011-01-21.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: 0.21318
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease pancreatic
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2xoga_
  • Chain 'B':
    Compound: ribonuclease pancreatic
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2xogb_
  • Heterogens: SFB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xogA (A:)
    ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
    knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
    dasv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xogA (A:)
    etaaakferqhmdsstasssnycnqmmksrnltkdrckpvntfvhesladvqavcsqknv
    ackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhfdas
    v
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2xogB (B:)
    ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
    knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
    dasv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xogB (B:)
    ketaaakferqhmdsstssnycnqmmksrnltkdrckpvntfvhesladvqavcsqknva
    ckngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhfdasv