PDB entry 2xku

View 2xku on RCSB PDB site
Description: Prion-like conversion during amyloid formation at atomic resolution
Class: immune system
Keywords: amyloidosis, immune system, ig-domain
Deposited on 2010-07-12, released 2011-02-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-15, with a file datestamp of 2020-01-10.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Beta-2-microglobulin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61769 (1-93)
    • expression tag (0)
  Domains in SCOPe 2.08: d2xkua1, d2xkua2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2xkuA (A:)
  miqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdwsfyll
  yyteftptekdeyacrvnhvtlsqpkivkwdrdm