PDB entry 2xj6

View 2xj6 on RCSB PDB site
Description: the structure of ferrous ascorbate peroxidase
Class: oxidoreductase
Keywords: oxidoreductase, ferryl ion
Deposited on 2010-07-02, released 2010-07-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-03-09, with a file datestamp of 2011-03-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.17252
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ascorbate peroxidase
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2xj6a_
  • Heterogens: HEM, SO4, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2xj6A (A:)
gksyptvsadyqkavekakkklrgfiaekrcaplmlrlawhsagtfdkgtktggpfgtik
hpaelahsanngldiavrlleplkaefpilsyadfyqlagvvavevtggpevpfhpgred
kpepppegrlpdatkgsdhlrdvfgkamgltdqdivalsgghtigaahkersgfegpwts
nplifdnsyftellsgekegllqlpsdkallsdpvfrplvdkyaadedaffadyaeahqk
lselgfada