PDB entry 2xig

View 2xig on RCSB PDB site
Description: the structure of the helicobacter pylori ferric uptake regulator fur reveals three functional metal binding sites
Class: transcription
Keywords: hpfur, transcription, homeostasis
Deposited on 2010-06-29, released 2011-01-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-04-06, with a file datestamp of 2011-04-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.1999
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferric uptake regulation protein
    Species: HELICOBACTER PYLORI [TaxId:85962]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O25671 (0-End)
      • engineered mutation (77)
    Domains in SCOPe 2.07: d2xiga_
  • Chain 'B':
    Compound: ferric uptake regulation protein
    Species: HELICOBACTER PYLORI [TaxId:85962]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O25671 (0-End)
      • engineered mutation (77)
    Domains in SCOPe 2.07: d2xigb_
  • Chain 'C':
    Compound: ferric uptake regulation protein
    Species: HELICOBACTER PYLORI [TaxId:85962]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O25671 (0-149)
      • engineered mutation (77)
      • engineered mutation (149)
    Domains in SCOPe 2.07: d2xigc_
  • Chain 'D':
    Compound: ferric uptake regulation protein
    Species: HELICOBACTER PYLORI [TaxId:85962]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O25671 (0-End)
      • engineered mutation (77)
    Domains in SCOPe 2.07: d2xigd_
  • Heterogens: ZN, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xigA (A:)
    mkrletlesilerlrmsikknglknskqreevvsvlyrsgthlspeeithsirqkdknts
    issvyrilnflekenfisvletsksgrryeiaakehhdhiiclhcgkiiefadpeienrq
    nevvkkyqaklishdmkmfvwckecqeses
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xigA (A:)
    mkrletlesilerlrmsikkngnskqreevvsvlyrsgthlspeeithsirqkdkntsis
    svyrilnflekenfisvletsksgrryeiaakehhdhiiclhcgkiiefadpeienrqne
    vvkkyqaklishdmkmfvwckecqes
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2xigB (B:)
    mkrletlesilerlrmsikknglknskqreevvsvlyrsgthlspeeithsirqkdknts
    issvyrilnflekenfisvletsksgrryeiaakehhdhiiclhcgkiiefadpeienrq
    nevvkkyqaklishdmkmfvwckecqeses
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xigB (B:)
    mkrletlesilerlrmsikknglknskqreevvsvlyrsgthlspeeithsirqkdknts
    issvyrilnflekenfisvletsksgrryeiaakehhdhiiclhcgkiiefadpeienrq
    nevvkkyqaklishdmkmfvwckecqes
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2xigC (C:)
    mkrletlesilerlrmsikknglknskqreevvsvlyrsgthlspeeithsirqkdknts
    issvyrilnflekenfisvletsksgrryeiaakehhdhiiclhcgkiiefadpeienrq
    nevvkkyqaklishdmkmfvwckecqeses
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2xigD (D:)
    mkrletlesilerlrmsikknglknskqreevvsvlyrsgthlspeeithsirqkdknts
    issvyrilnflekenfisvletsksgrryeiaakehhdhiiclhcgkiiefadpeienrq
    nevvkkyqaklishdmkmfvwckecqeses
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xigD (D:)
    mkrletlesilerlrmsikknglknskqreevvsvlyrsgthlspeeithsirqkdknts
    issvyrilnflekenfisvletsksgrryeiaakehhdhiiclhcgkiiefadpeienrq
    nevvkkyqaklishdmkmfvwckecqes