PDB entry 2xhy

View 2xhy on RCSB PDB site
Description: Crystal Structure of E.coli BglA
Class: hydrolase
Keywords: hydrolase, glycosidase
Deposited on 2010-06-24, released 2011-07-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-03-28, with a file datestamp of 2012-03-23.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.174
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 6-phospho-beta-glucosidase bgla
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xhya_
  • Chain 'B':
    Compound: 6-phospho-beta-glucosidase bgla
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xhyb_
  • Chain 'C':
    Compound: 6-phospho-beta-glucosidase bgla
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xhyc_
  • Chain 'D':
    Compound: 6-phospho-beta-glucosidase bgla
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xhyd_
  • Heterogens: BR, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xhyA (A:)
    mivkkltlpkdflwggavaahqveggwnkggkgpsicdvltggahgvpreitkevlpgky
    ypnheavdfyghykediklfaemgfkcfrtsiawtrifpkgdeaqpneeglkfyddmfde
    llkyniepvitlshfemplhlvqqygswtnrkvvdffvrfaevvferykhkvkywmtfne
    innqrnwraplfgyccsgvvytehenpeetmyqvlhhqfvasalavkaarrinpemkvgc
    mlamvplypyscnpddvmfaqesmreryvftdvqlrgyypsyvlnewerrgfnikmedgd
    ldvlregtcdylgfsyymtnavkaeggtgdaisgfegsvpnpyvkasdwgwqidpvglry
    alcelyeryqrplfivengfgaydkveedgsinddyridylrahieemkkavtydgvdlm
    gytpwgcidcvsfttgqyskrygfiyvnkhddgtgdmsrsrkksfnwykeviasngekl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xhyA (A:)
    kkltlpkdflwggavaahqveggwnkggkgpsicdvltggahgvpreitkevlpgkyypn
    heavdfyghykediklfaemgfkcfrtsiawtrifpkgdeaqpneeglkfyddmfdellk
    yniepvitlshfemplhlvqqygswtnrkvvdffvrfaevvferykhkvkywmtfneinn
    qrnwraplfgyccsgvvytehenpeetmyqvlhhqfvasalavkaarrinpemkvgcmla
    mvplypyscnpddvmfaqesmreryvftdvqlrgyypsyvlnewerrgfnikmedgdldv
    lregtcdylgfsyymtnavkaeggtfegsvpnpyvkasdwgwqidpvglryalcelyery
    qrplfivengfgaydkveedgsinddyridylrahieemkkavtydgvdlmgytpwgcid
    cvsfttgqyskrygfiyvnkhddgtgdmsrsrkksfnwykeviasngekl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2xhyB (B:)
    mivkkltlpkdflwggavaahqveggwnkggkgpsicdvltggahgvpreitkevlpgky
    ypnheavdfyghykediklfaemgfkcfrtsiawtrifpkgdeaqpneeglkfyddmfde
    llkyniepvitlshfemplhlvqqygswtnrkvvdffvrfaevvferykhkvkywmtfne
    innqrnwraplfgyccsgvvytehenpeetmyqvlhhqfvasalavkaarrinpemkvgc
    mlamvplypyscnpddvmfaqesmreryvftdvqlrgyypsyvlnewerrgfnikmedgd
    ldvlregtcdylgfsyymtnavkaeggtgdaisgfegsvpnpyvkasdwgwqidpvglry
    alcelyeryqrplfivengfgaydkveedgsinddyridylrahieemkkavtydgvdlm
    gytpwgcidcvsfttgqyskrygfiyvnkhddgtgdmsrsrkksfnwykeviasngekl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xhyB (B:)
    kkltlpkdflwggavaahqveggwnkggkgpsicdvltggahgvpreitkevlpgkyypn
    heavdfyghykediklfaemgfkcfrtsiawtrifpkgdeaqpneeglkfyddmfdellk
    yniepvitlshfemplhlvqqygswtnrkvvdffvrfaevvferykhkvkywmtfneinn
    qrnwraplfgyccsgvvytehenpeetmyqvlhhqfvasalavkaarrinpemkvgcmla
    mvplypyscnpddvmfaqesmreryvftdvqlrgyypsyvlnewerrgfnikmedgdldv
    lregtcdylgfsyymtnavkaeggegsvpnpyvkasdwgwqidpvglryalcelyeryqr
    plfivengfgaydkveedgsinddyridylrahieemkkavtydgvdlmgytpwgcidcv
    sfttgqyskrygfiyvnkhddgtgdmsrsrkksfnwykeviasngekl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2xhyC (C:)
    mivkkltlpkdflwggavaahqveggwnkggkgpsicdvltggahgvpreitkevlpgky
    ypnheavdfyghykediklfaemgfkcfrtsiawtrifpkgdeaqpneeglkfyddmfde
    llkyniepvitlshfemplhlvqqygswtnrkvvdffvrfaevvferykhkvkywmtfne
    innqrnwraplfgyccsgvvytehenpeetmyqvlhhqfvasalavkaarrinpemkvgc
    mlamvplypyscnpddvmfaqesmreryvftdvqlrgyypsyvlnewerrgfnikmedgd
    ldvlregtcdylgfsyymtnavkaeggtgdaisgfegsvpnpyvkasdwgwqidpvglry
    alcelyeryqrplfivengfgaydkveedgsinddyridylrahieemkkavtydgvdlm
    gytpwgcidcvsfttgqyskrygfiyvnkhddgtgdmsrsrkksfnwykeviasngekl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xhyC (C:)
    kltlpkdflwggavaahqveggwnkggkgpsicdvltggahgvpreitkevlpgkyypnh
    eavdfyghykediklfaemgfkcfrtsiawtrifpkgdeaqpneeglkfyddmfdellky
    niepvitlshfemplhlvqqygswtnrkvvdffvrfaevvferykhkvkywmtfneinnq
    rnwraplfgyccsgvvytehenpeetmyqvlhhqfvasalavkaarrinpemkvgcmlam
    vplypyscnpddvmfaqesmreryvftdvqlrgyypsyvlnewerrgfnikmedgdldvl
    regtcdylgfsyymtnavkaegggsvpnpyvkasdwgwqidpvglryalcelyeryqrpl
    fivengfgaydkveedgsinddyridylrahieemkkavtydgvdlmgytpwgcidcvsf
    ttgqyskrygfiyvnkhddgtgdmsrsrkksfnwykeviasngekl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2xhyD (D:)
    mivkkltlpkdflwggavaahqveggwnkggkgpsicdvltggahgvpreitkevlpgky
    ypnheavdfyghykediklfaemgfkcfrtsiawtrifpkgdeaqpneeglkfyddmfde
    llkyniepvitlshfemplhlvqqygswtnrkvvdffvrfaevvferykhkvkywmtfne
    innqrnwraplfgyccsgvvytehenpeetmyqvlhhqfvasalavkaarrinpemkvgc
    mlamvplypyscnpddvmfaqesmreryvftdvqlrgyypsyvlnewerrgfnikmedgd
    ldvlregtcdylgfsyymtnavkaeggtgdaisgfegsvpnpyvkasdwgwqidpvglry
    alcelyeryqrplfivengfgaydkveedgsinddyridylrahieemkkavtydgvdlm
    gytpwgcidcvsfttgqyskrygfiyvnkhddgtgdmsrsrkksfnwykeviasngekl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xhyD (D:)
    kltlpkdflwggavaahqveggwnkggkgpsicdvltggahgvpreitkevlpgkyypnh
    eavdfyghykediklfaemgfkcfrtsiawtrifpkgdeaqpneeglkfyddmfdellky
    niepvitlshfemplhlvqqygswtnrkvvdffvrfaevvferykhkvkywmtfneinnq
    rnwraplfgyccsgvvytehenpeetmyqvlhhqfvasalavkaarrinpemkvgcmlam
    vplypyscnpddvmfaqesmreryvftdvqlrgyypsyvlnewerrgfnikmedgdldvl
    regtcdylgfsyymtnavkaegsvpnpyvkasdwgwqidpvglryalcelyeryqrplfi
    vengfgaydkveedgsinddyridylrahieemkkavtydgvdlmgytpwgcidcvsftt
    gqyskrygfiyvnkhddgtgdmsrsrkksfnwykeviasngekl