PDB entry 2xhs

View 2xhs on RCSB PDB site
Description: crystal structure of the ligand binding domain of fushi tarazu factor 1 of drosophila melanogaster.
Class: transcription
Keywords: transcription
Deposited on 2010-06-21, released 2011-07-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-09-14, with a file datestamp of 2011-09-09.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.219
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nuclear hormone receptor ftz-f1
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33244 (7-End)
      • expression tag (0-6)
    Domains in SCOPe 2.07: d2xhsa1, d2xhsa2
  • Chain 'B':
    Compound: segmentation protein fushi tarazu
    Species: DROSOPHILA MELANOGASTER, synthetic [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xhsA (A:)
    gshmledplrvspmirefvqsiddrewqtqlfallqkqtynqvevdlfelmckvldqnlf
    sqvdwarntvffkdlkvddqmkllqhswsdmlvldhlhhrihnglpdetqlnngqvfnlm
    slgllgvpqlgdyfnelqnklqdlkfdmgdyvcmkflillnpsvrgivnrktvseghdnv
    qaalldytltcypsvndkfrglvnilpeihamavrgedhlytkhcagsaptqtllmemlh
    akrkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xhsA (A:)
    gshmledplrvspmirefvqsiddrewqtqlfallqkqtynqvevdlfelmckvldqnlf
    sqvdwarntvffkdlkvddqmkllqhswsdmlvldhlhhrihnglpdetqlnngqvfnlm
    slgllgvpqlgdyfnelqnklqdlkfdmgdyvcmkflillnpsvrgivnrktvseghdnv
    qaalldytltcypsvndkfrglvnilpeihamavrgedhlytkhcagsaptqtllmemlh
    akrk
    

  • Chain 'B':
    No sequence available.