PDB entry 2xhn

View 2xhn on RCSB PDB site
Description: rhamnogalacturonan lyase from aspergillus aculeatus k150a active site mutant
Class: lyase
Keywords: carbohydrate active enzyme, lyase, pectin, degradation, polysaccharide lyase family 4
Deposited on 2010-06-18, released 2010-09-29
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-04-20, with a file datestamp of 2011-04-15.
Experiment type: XRAY
Resolution: 1.52 Å
R-factor: 0.1159
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rhamnogalacturonase B
    Species: Aspergillus aculeatus [TaxId:5053]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00019 (0-507)
      • engineered mutation (149)
    Domains in SCOPe 2.04: d2xhna1, d2xhna2, d2xhna3
  • Chain 'B':
    Compound: Rhamnogalacturonase B
    Species: Aspergillus aculeatus [TaxId:5053]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00019 (0-507)
      • engineered mutation (149)
    Domains in SCOPe 2.04: d2xhnb1, d2xhnb2, d2xhnb3
  • Heterogens: CA, SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2xhnA (A:)
    afgittsssayvidtnapnqlkftvsrsscditsiihygtelqyssqgshigsglgsatv
    tatqsgdyikvtcvtdtltqymvvhngdpiihmatyitaepsigelrfiarlnsdllpne
    epfgdvsttadgtaiegsdvflvgsetrsafysserfiddqrhciagdahrvcmilnqye
    sssggpfhrdinsnnggsynalywymnsghvqtesyrmglhgpysmyfsrsgtpstsidt
    sffadldikgyvaasgrgkvagtasgadssmdwvvhwyndaaqywtytsssgsftspamk
    pgtytmvyyqgeyavatssvtvsagstttknisgsvktgttifkigewdgqptgfrnaan
    qlrmhpsdsrmsswgpltytvgssaltdfpmavfksvnnpvtikftatsaqtgaatlrig
    ttlsfaggrpqatinsytgsapaaptnldsrgvtrgayrglgevydvsipsgtivagtnt
    itinvisgssgdtylspnfifdcvelfq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2xhnB (B:)
    afgittsssayvidtnapnqlkftvsrsscditsiihygtelqyssqgshigsglgsatv
    tatqsgdyikvtcvtdtltqymvvhngdpiihmatyitaepsigelrfiarlnsdllpne
    epfgdvsttadgtaiegsdvflvgsetrsafysserfiddqrhciagdahrvcmilnqye
    sssggpfhrdinsnnggsynalywymnsghvqtesyrmglhgpysmyfsrsgtpstsidt
    sffadldikgyvaasgrgkvagtasgadssmdwvvhwyndaaqywtytsssgsftspamk
    pgtytmvyyqgeyavatssvtvsagstttknisgsvktgttifkigewdgqptgfrnaan
    qlrmhpsdsrmsswgpltytvgssaltdfpmavfksvnnpvtikftatsaqtgaatlrig
    ttlsfaggrpqatinsytgsapaaptnldsrgvtrgayrglgevydvsipsgtivagtnt
    itinvisgssgdtylspnfifdcvelfq