PDB entry 2xhl

View 2xhl on RCSB PDB site
Description: structure of a functional derivative of clostridium botulinum neurotoxin type b
Class: hydrolase
Keywords: hydrolase, metalloprotease, membrane domain, endopeptidase, zinc protease, botulism, toxin
Deposited on 2010-06-18, released 2010-12-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-06, with a file datestamp of 2011-07-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.24213
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Botulinum neurotoxin B light chain
    Species: Clostridium botulinum [TaxId:1491]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10844 (0-436)
      • expression tag (437-440)
  • Chain 'B':
    Compound: botulinum neurotoxin b heavy chain
    Species: Clostridium botulinum [TaxId:1491]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10844 (7-End)
      • expression tag (4-6)
    Domains in SCOPe 2.07: d2xhlb1, d2xhlb2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2xhlB (B:)
    nkalnlqcidvdnedlffiadknsfsddlsknerieyntqsnyiendfpinelildtdli
    skielpsentesltdfnvdvpvyekqpaikkiftdentifqylysqtfpldirdisltss
    fddallfsnkvysffsmdyiktankvveaglfagwvkqivndfvieanksntmdkiadis
    livpyiglalnvgnetakgnfenafeiagasillefipellipvvgafllesyidnknki
    iktidnaltkrnekwsdmyglivaqwlstvntqfytikegmykalnyqaqaleeiikyry
    niysekeksninidfndinsklneginqaidninnfingcsvsylmkkmiplaveklldf
    dntlkknllnyidenklyligsaeyekskvnkylktimpfdlsiytndtiliemfnkyns
    lealasghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xhlB (B:)
    nlqcidvdnedlffiadknsfsddlsknerieyntqsnyiendfpinelildtdliskie
    lpsentesltdfnvdvpvyekqpaikkiftdentifqylysqtfpldirdisltssfdda
    llfsnkvysffsmdyiktankvveaglfagwvkqivndfvieanksntdislivpyigla
    lnvgnetakgnfenafeiagasillefipellipvvgafllesyidnknkiiktidnalt
    krnekwsdmyglivaqwlstvntqfytikegmykalnyqaqaleeiikyryniysekeks
    ninidfndinsklneginqaidninnfingcsvsylmkkmiplaveklldfdntlkknll
    nyidenklyligsaeyekskvnkylktimpfdlsiytndtiliemfnkyn