PDB entry 2xhi

View 2xhi on RCSB PDB site
Description: Separation-of-function mutants unravel the dual reaction mode of human 8-oxoguanine DNA glycosylase
Class: lyase/DNA
Keywords: lyase-DNA complex, separation-of-function mutant, helix-hairpin-helix, DNA repair
Deposited on 2010-06-16, released 2011-01-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-09-10, with a file datestamp of 2014-09-05.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.23113
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N-glycosylase/DNA lyase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15527
      • engineered mutation (263)
      • engineered mutation (267)
      • engineered mutation (282)
    Domains in SCOPe 2.07: d2xhia1, d2xhia2
  • Chain 'B':
    Compound: 5'-d(*gp*gp*tp*ap*gp*ap*cp*cp*tp*gp*gp*ap*cp*gp*c)-3'
  • Chain 'C':
    Compound: 5'-d(*gp*cp*gp*tp*cp*cp*ap*(8og)p*gp*tp*cp*tp*ap*cp*c)-3'
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xhiA (A:)
    mgshhhhhhsqdpnsmparallprrmghrtlastpalwasipcprselrldlvlpsgqsf
    rwreqspahwsgvladqvwtltqteeqlhctvyrgdksqasrptpdeleavrkyfqldvt
    laqlyhhwgsvdshfqevaqkfqgvrllrqdpieclfsficssnnniaritgmverlcqa
    fgprliqlddvtyhgfpslqalagpeveahlrklglgyraryvsasaraileeqgglawl
    qqlressyeeahkalcilpgvgtcvadkiclmaldkpqavpvnvhmwhiaqrdyswhptt
    sqakgpspqtnkelgnffrslwgpyagwaqavlfsadlrqsrhaqeppakrrkgskgpeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xhiA (A:)
    rmghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltqt
    eeqlhctvyrgdksqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfqg
    vrllrqdpieclfsficssnnniaritgmverlcqafgprliqlddvtyhgfpslqalag
    peveahlrklglgyraryvsasaraileeqgglawlqqlressyeeahkalcilpgvgtc
    vadkiclmaldkpqavpvnvhmwhiaqrdyswhpttsqakgpspqtnkelgnffrslwgp
    yagwaqavlfsadlrq
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.