PDB entry 2xh8

View 2xh8 on RCSB PDB site
Description: x-ray structure of 119-141 znua deletion mutant from salmonella enterica.
Class: transport protein
Keywords: transport protein, metal transport
Deposited on 2010-06-09, released 2011-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-31, with a file datestamp of 2011-08-26.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: 0.19687
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: zinc abc transporter, periplasmic zinc-binding protein
    Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:90371]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2xh8a_
  • Heterogens: NA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xh8A (A:)
    mlqkntllfaalsaalwgsatqaadaavvaslkplgfiasaiadgvtdtqvllpdgaseh
    dyslrpsdvkrlqgadlvvwvgpemeafmeksvrnipdnkqvtiaqladvkpllmkgage
    ynmhlwlspeiaratavaiheklvelmpqsrakldanlkdfeaqlaatdkqvgnelaplk
    gkgyfvfhdaygyyekhygltplghftvnpeiqpgaqrlheirtqlveqkatcvfaepqf
    rpavveavargtsvrmgtldplgtniklgktsysaflsqlanqyasclkgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xh8A (A:)
    avvaslkplgfiasaiadgvtdtqvllpdgasehdyslrpsdvkrlqgadlvvwvgpeme
    afmeksvrnipdnkqvtiaqladvkpllmkgageynmhlwlspeiaratavaiheklvel
    mpqsrakldanlkdfeaqlaatdkqvgnelaplkgkgyfvfhdaygyyekhygltplghf
    tvnpeiqpgaqrlheirtqlveqkatcvfaepqfrpavveavargtsvrmgtldplgtni
    klgktsysaflsqlanqyasclkg