PDB entry 2xh4

View 2xh4 on RCSB PDB site
Description: engineering the enolase active site pocket: crystal structure of the s39a d321a mutant of yeast enolase 1
Class: lyase
Keywords: lyase, tim-barrel, enolase superfamily, glycolysis, gluconeogenesis, metal binding
Deposited on 2010-06-09, released 2010-08-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-04-20, with a file datestamp of 2011-04-15.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.236
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enolase 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00924 (0-435)
      • expression tag (436-437)
      • engineered mutation (38)
      • conflict (240)
      • engineered mutation (320)
    Domains in SCOPe 2.06: d2xh4a1, d2xh4a2, d2xh4a3
  • Chain 'B':
    Compound: enolase 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00924 (0-435)
      • expression tag (436-437)
      • conflict (240)
      • engineered mutation (320)
    Domains in SCOPe 2.06: d2xh4b1, d2xh4b2, d2xh4b3
  • Chain 'C':
    Compound: enolase 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00924 (0-435)
      • expression tag (436-437)
      • engineered mutation (38)
      • conflict (240)
      • engineered mutation (320)
    Domains in SCOPe 2.06: d2xh4c1, d2xh4c2, d2xh4c3
  • Chain 'D':
    Compound: enolase 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00924 (0-435)
      • expression tag (436-437)
      • conflict (240)
      • engineered mutation (320)
    Domains in SCOPe 2.06: d2xh4d1, d2xh4d2, d2xh4d3
  • Heterogens: MG, 2PG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xh4A (A:)
    avskvyarsvydsrgnptvevelttekgvfrsivpsgaatgvhealemrdgdkskwmgkg
    vlhavknvndviapafvkanidvkdqkavddflisldgtanksklganailgvslaasra
    aaaeknvplykhladlsksktspyvlpvpflnvlnggshaggalalqefmiaptgaktfa
    ealrigsevyhnlksltkkrygasagnvgdeggvapniqtaeealdlivdaikaaghdgk
    ikigldcasseffkdgkydldfknpnsdkskwltgpqladlyhslmkrypivsiedpfae
    ddweawshffktagiqivadaltvtnpkriataiekkaadalllkvnqigtlsesikaaq
    dsfaagwgvmvshrsgetedtfiadlvvglrtgqiktgaparserlaklnqllrieeelg
    dnavfagenfhhgdkllhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xh4A (A:)
    avskvyarsvydsrgnptvevelttekgvfrsivpsgaatgvhealemrdgdkskwmgkg
    vlhavknvndviapafvkanidvkdqkavddflisldgtanksklganailgvslaasra
    aaaeknvplykhladlsksktspyvlpvpflnvlnggshaggalalqefmiaptgaktfa
    ealrigsevyhnlksltkkrygasagnvgdeggvapniqtaeealdlivdaikaaghdgk
    ikigldcasseffkdgkydldfknpnsdkskwltgpqladlyhslmkrypivsiedpfae
    ddweawshffktagiqivadaltvtnpkriataiekkaadalllkvnqigtlsesikaaq
    dsfaagwgvmvshrsgetedtfiadlvvglrtgqiktgaparserlaklnqllrieeelg
    dnavfagenfhhgdkllh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2xh4B (B:)
    avskvyarsvydsrgnptvevelttekgvfrsivpsgaatgvhealemrdgdkskwmgkg
    vlhavknvndviapafvkanidvkdqkavddflisldgtanksklganailgvslaasra
    aaaeknvplykhladlsksktspyvlpvpflnvlnggshaggalalqefmiaptgaktfa
    ealrigsevyhnlksltkkrygasagnvgdeggvapniqtaeealdlivdaikaaghdgk
    ikigldcasseffkdgkydldfknpnsdkskwltgpqladlyhslmkrypivsiedpfae
    ddweawshffktagiqivadaltvtnpkriataiekkaadalllkvnqigtlsesikaaq
    dsfaagwgvmvshrsgetedtfiadlvvglrtgqiktgaparserlaklnqllrieeelg
    dnavfagenfhhgdkllhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xh4B (B:)
    avskvyarsvydsrgnptvevelttekgvfrsivpsggvlhavknvndviapafvkanid
    vkdqkavddflisldgtanksklganailgvslaasraaaaeknvplykhladlskskts
    pyvlpvpflnvlnggshaggalalqefmiaptgaktfaealrigsevyhnlksltkkryg
    asagnvgdeggvapniqtaeealdlivdaikaaghdgkikigldcasseffkdgkydldf
    knnsdkskwltgpqladlyhslmkrypivsiedpfaeddweawshffktagiqivadalt
    vtnpkriataiekkaadalllkvnqigtlsesikaaqdsfaagwgvmvshrsgetedtfi
    adlvvglrtgqiktgaparserlaklnqllrieeelgdnavfagenfhhgdkllh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2xh4C (C:)
    avskvyarsvydsrgnptvevelttekgvfrsivpsgaatgvhealemrdgdkskwmgkg
    vlhavknvndviapafvkanidvkdqkavddflisldgtanksklganailgvslaasra
    aaaeknvplykhladlsksktspyvlpvpflnvlnggshaggalalqefmiaptgaktfa
    ealrigsevyhnlksltkkrygasagnvgdeggvapniqtaeealdlivdaikaaghdgk
    ikigldcasseffkdgkydldfknpnsdkskwltgpqladlyhslmkrypivsiedpfae
    ddweawshffktagiqivadaltvtnpkriataiekkaadalllkvnqigtlsesikaaq
    dsfaagwgvmvshrsgetedtfiadlvvglrtgqiktgaparserlaklnqllrieeelg
    dnavfagenfhhgdkllhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xh4C (C:)
    avskvyarsvydsrgnptvevelttekgvfrsivpsgaatgvhealemrdgdkskwmgkg
    vlhavknvndviapafvkanidvkdqkavddflisldgtanksklganailgvslaasra
    aaaeknvplykhladlsksktspyvlpvpflnvlnggshaggalalqefmiaptgaktfa
    ealrigsevyhnlksltkkrygasagnvgdeggvapniqtaeealdlivdaikaaghdgk
    ikigldcasseffkdgkydldfknpnsdkskwltgpqladlyhslmkrypivsiedpfae
    ddweawshffktagiqivadaltvtnpkriataiekkaadalllkvnqigtlsesikaaq
    dsfaagwgvmvshrsgetedtfiadlvvglrtgqiktgaparserlaklnqllrieeelg
    dnavfagenfhhgdkllh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2xh4D (D:)
    avskvyarsvydsrgnptvevelttekgvfrsivpsgaatgvhealemrdgdkskwmgkg
    vlhavknvndviapafvkanidvkdqkavddflisldgtanksklganailgvslaasra
    aaaeknvplykhladlsksktspyvlpvpflnvlnggshaggalalqefmiaptgaktfa
    ealrigsevyhnlksltkkrygasagnvgdeggvapniqtaeealdlivdaikaaghdgk
    ikigldcasseffkdgkydldfknpnsdkskwltgpqladlyhslmkrypivsiedpfae
    ddweawshffktagiqivadaltvtnpkriataiekkaadalllkvnqigtlsesikaaq
    dsfaagwgvmvshrsgetedtfiadlvvglrtgqiktgaparserlaklnqllrieeelg
    dnavfagenfhhgdkllhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xh4D (D:)
    avskvyarsvydsrgnptvevelttekgvfrsivpsggvlhavknvndviapafvkanid
    vkdqkavddflisldgtanksklganailgvslaasraaaaeknvplykhladlskskts
    pyvlpvpflnvlnggshaggalalqefmiaptgaktfaealrigsevyhnlksltkkryg
    asagnvgdeggvapniqtaeealdlivdaikaaghdgkikigldcasseffkdgkydldf
    knnsdkskwltgpqladlyhslmkrypivsiedpfaeddweawshffktagiqivadalt
    vtnpkriataiekkaadalllkvnqigtlsesikaaqdsfaagwgvmvshrsgetedtfi
    adlvvglrtgqiktgaparserlaklnqllrieeelgdnavfagenfhhgdkllh