PDB entry 2xgw

View 2xgw on RCSB PDB site
Description: zinc-bound crystal structure of streptococcus pyogenes dpr
Class: metal binding protein
Keywords: metal binding protein
Deposited on 2010-06-08, released 2010-08-11
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-08-11, with a file datestamp of 2010-08-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.14531
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peroxide resistance protein
    Species: Streptococcus pyogenes [TaxId:1314]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7CN02 (Start-190)
      • conflict (94)
    Domains in SCOPe 2.04: d2xgwa_
  • Heterogens: ZN, CL, SIN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xgwA (A:)
    masmtggqqmgrdpnsmtntlveniyasvthniskkeasknektkavlnqavadlsvaas
    ivhqvhwymrgpgflylhpkmdelldslnanldevserlitiggapystlaefskhskld
    eakgtydktvaqhlarlvevylylsslyqvglditdeegdagtndlftaakteaektiwm
    lqaergqgpallehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xgwA (A:)
    tlveniyasvthnsknektkavlnqavadlsvaasivhqvhwymrgpgflylhpkmdell
    dslnanldevserlitiggapystlaefskhskldeakgtydktvaqhlarlvevylyls
    slyqvglditdeegdagtndlftaakteaektiwmlqaergqgpal