PDB entry 2xfu

View 2xfu on RCSB PDB site
Description: human monoamine oxidase b with tranylcypromine
Class: oxidoreductase
Keywords: flavoprotein, oxidoreductase
Deposited on 2010-05-26, released 2010-06-09
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-11-24, with a file datestamp of 2010-11-19.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.18946
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amine oxidase [flavin-containing] b
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2xfua1, d2xfua2
  • Chain 'B':
    Compound: amine oxidase [flavin-containing] b
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2xfub1, d2xfub2
  • Heterogens: FA8, 3PL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xfuA (A:)
    snkcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsyv
    gptqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwrt
    mddmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethevs
    alwflwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidqt
    renvlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvplgsvikcivyy
    kepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeerl
    kklcelyakvlgslealepvhyeeknwceeqysggcyttyfppgiltqygrvlrqpvdri
    yfagtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvpaqpitttf
    lerhlpsvpgllrliglttifsatalgflahkrgllvrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xfuA (A:)
    nkcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsyvg
    ptqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwrtm
    ddmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethevsa
    lwflwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidqtr
    envlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvplgsvikcivyyk
    epfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeerlk
    klcelyakvlgslealepvhyeeknwceeqysggcyttyfppgiltqygrvlrqpvdriy
    fagtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvpaqpitttfl
    erhlpsvpgllrligltti
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2xfuB (B:)
    snkcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsyv
    gptqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwrt
    mddmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethevs
    alwflwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidqt
    renvlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvplgsvikcivyy
    kepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeerl
    kklcelyakvlgslealepvhyeeknwceeqysggcyttyfppgiltqygrvlrqpvdri
    yfagtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvpaqpitttf
    lerhlpsvpgllrliglttifsatalgflahkrgllvrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xfuB (B:)
    nkcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsyvg
    ptqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwrtm
    ddmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethevsa
    lwflwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidqtr
    envlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvplgsvikcivyyk
    epfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeerlk
    klcelyakvlgslealepvhyeeknwceeqysggcyttyfppgiltqygrvlrqpvdriy
    fagtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvpaqpitttfl
    erhlpsvpgllrli