PDB entry 2xe5

View 2xe5 on RCSB PDB site
Description: molecular insights into clinically isolated ompc mutants and their role in multi-drug resistance (ompc26)
Class: transport protein
Keywords: cell membrane, transport protein, ion transport, porin
Deposited on 2010-05-11, released 2010-05-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: 0.22804
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: outer membrane porin c
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K597 (0-342)
      • see remark 999 (17)
    Domains in SCOPe 2.07: d2xe5a_
  • Chain 'B':
    Compound: outer membrane porin c
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K597 (0-342)
      • see remark 999 (17)
    Domains in SCOPe 2.07: d2xe5b_
  • Chain 'C':
    Compound: outer membrane porin c
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K597 (0-342)
      • see remark 999 (17)
    Domains in SCOPe 2.07: d2xe5c_
  • Chain 'D':
    Compound: outer membrane porin c
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K597 (0-342)
      • see remark 999 (17)
    Domains in SCOPe 2.07: d2xe5d_
  • Chain 'E':
    Compound: outer membrane porin c
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K597 (0-342)
      • see remark 999 (17)
    Domains in SCOPe 2.07: d2xe5e_
  • Chain 'F':
    Compound: outer membrane porin c
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K597 (0-342)
      • see remark 999 (17)
    Domains in SCOPe 2.07: d2xe5f_
  • Heterogens: C8E, HEX, D12, OCT, SO4, D10, ASZ, OES, HP6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2xe5A (A:)
    aeiynkdgnkldlygkveglhyfsdndskdgdktymrlgfkgetqvtdqltgygqweyqi
    qgnepesdnsswtrvafaglkfqdvgsfdygrnygvvydvtswtdvlpefggdtydsdnf
    mqqrgngfatyrntdffglvdgldfavqyqgkngsahgegmttngrddvfeqngdgvggs
    itynyegfgigaavssskrtwdqnntgligtgdraetytgglkydanniylaaqytqtyn
    atrvgslgwankaqnfeavaqyqfdfglrpslaylqskgknlgrgyddedilkyvdvgat
    yyfnknmstyvdykinllddnrftrdagintddivalglvyqf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2xe5B (B:)
    aeiynkdgnkldlygkveglhyfsdndskdgdktymrlgfkgetqvtdqltgygqweyqi
    qgnepesdnsswtrvafaglkfqdvgsfdygrnygvvydvtswtdvlpefggdtydsdnf
    mqqrgngfatyrntdffglvdgldfavqyqgkngsahgegmttngrddvfeqngdgvggs
    itynyegfgigaavssskrtwdqnntgligtgdraetytgglkydanniylaaqytqtyn
    atrvgslgwankaqnfeavaqyqfdfglrpslaylqskgknlgrgyddedilkyvdvgat
    yyfnknmstyvdykinllddnrftrdagintddivalglvyqf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2xe5C (C:)
    aeiynkdgnkldlygkveglhyfsdndskdgdktymrlgfkgetqvtdqltgygqweyqi
    qgnepesdnsswtrvafaglkfqdvgsfdygrnygvvydvtswtdvlpefggdtydsdnf
    mqqrgngfatyrntdffglvdgldfavqyqgkngsahgegmttngrddvfeqngdgvggs
    itynyegfgigaavssskrtwdqnntgligtgdraetytgglkydanniylaaqytqtyn
    atrvgslgwankaqnfeavaqyqfdfglrpslaylqskgknlgrgyddedilkyvdvgat
    yyfnknmstyvdykinllddnrftrdagintddivalglvyqf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2xe5D (D:)
    aeiynkdgnkldlygkveglhyfsdndskdgdktymrlgfkgetqvtdqltgygqweyqi
    qgnepesdnsswtrvafaglkfqdvgsfdygrnygvvydvtswtdvlpefggdtydsdnf
    mqqrgngfatyrntdffglvdgldfavqyqgkngsahgegmttngrddvfeqngdgvggs
    itynyegfgigaavssskrtwdqnntgligtgdraetytgglkydanniylaaqytqtyn
    atrvgslgwankaqnfeavaqyqfdfglrpslaylqskgknlgrgyddedilkyvdvgat
    yyfnknmstyvdykinllddnrftrdagintddivalglvyqf
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2xe5E (E:)
    aeiynkdgnkldlygkveglhyfsdndskdgdktymrlgfkgetqvtdqltgygqweyqi
    qgnepesdnsswtrvafaglkfqdvgsfdygrnygvvydvtswtdvlpefggdtydsdnf
    mqqrgngfatyrntdffglvdgldfavqyqgkngsahgegmttngrddvfeqngdgvggs
    itynyegfgigaavssskrtwdqnntgligtgdraetytgglkydanniylaaqytqtyn
    atrvgslgwankaqnfeavaqyqfdfglrpslaylqskgknlgrgyddedilkyvdvgat
    yyfnknmstyvdykinllddnrftrdagintddivalglvyqf
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2xe5F (F:)
    aeiynkdgnkldlygkveglhyfsdndskdgdktymrlgfkgetqvtdqltgygqweyqi
    qgnepesdnsswtrvafaglkfqdvgsfdygrnygvvydvtswtdvlpefggdtydsdnf
    mqqrgngfatyrntdffglvdgldfavqyqgkngsahgegmttngrddvfeqngdgvggs
    itynyegfgigaavssskrtwdqnntgligtgdraetytgglkydanniylaaqytqtyn
    atrvgslgwankaqnfeavaqyqfdfglrpslaylqskgknlgrgyddedilkyvdvgat
    yyfnknmstyvdykinllddnrftrdagintddivalglvyqf