PDB entry 2xe3

View 2xe3 on RCSB PDB site
Description: ompc28
Class: transport protein
Keywords: cell membrane, transport protein, ion transport, porin
Deposited on 2010-05-10, released 2010-05-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.215
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: outer membrane porin c
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K597 (0-342)
      • see remark 999 (17)
      • see remark 999 (270)
    Domains in SCOPe 2.07: d2xe3a_
  • Chain 'B':
    Compound: outer membrane porin c
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K597 (0-342)
      • see remark 999 (17)
      • see remark 999 (270)
    Domains in SCOPe 2.07: d2xe3b_
  • Heterogens: BOG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2xe3A (A:)
    aeiynkdgnkldlygkveglhyfsdndskdgdktymrlgfkgetqvtdqltgygqweyqi
    qgnepesdnsswtrvafaglkfqdvgsfdygrnygvvydvtswtdvlpefggdtydsdnf
    mqqrgngfatyrntdffglvdgldfavqyqgkngsahgegmttngrddvfeqngdgvggs
    itynyegfgigaavssskrtwdqnntgligtgdraetytgglkydanniylaaqytqtyn
    atrvgslgwankaqnfeavaqyqfdfglrpflaylqskgknlgrgyddedilkyvdvgat
    yyfnknmstyvdykinllddnrftrdagintddivalglvyqf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2xe3B (B:)
    aeiynkdgnkldlygkveglhyfsdndskdgdktymrlgfkgetqvtdqltgygqweyqi
    qgnepesdnsswtrvafaglkfqdvgsfdygrnygvvydvtswtdvlpefggdtydsdnf
    mqqrgngfatyrntdffglvdgldfavqyqgkngsahgegmttngrddvfeqngdgvggs
    itynyegfgigaavssskrtwdqnntgligtgdraetytgglkydanniylaaqytqtyn
    atrvgslgwankaqnfeavaqyqfdfglrpflaylqskgknlgrgyddedilkyvdvgat
    yyfnknmstyvdykinllddnrftrdagintddivalglvyqf