PDB entry 2xe1

View 2xe1 on RCSB PDB site
Description: molecular insights into clinically isolated ompc mutants and their role in multi-drug resistance
Class: transport protein
Keywords: transport protein, ion transport, porin, antibiotic resistance, cell outer membrane, beta barrel, membrane protein
Deposited on 2010-05-10, released 2010-05-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.19414
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Outer membrane protein C
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2xe1a_
  • Heterogens: D10, HEX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2xe1A (A:)
    aevynkdgnkldlygkvdglhyfsddksvdgdqtymrlgfkgetqvtdqltgygqweyqi
    qgnapesennswtrvafaglkfqdigsfdygrnygvvydvtswtdvlpefggdtygsdnf
    mqqrgngfatyrntdffglvdglnfavqyqgqngsvsgendpdftghgitnngrkalrqn
    gdgvggsitydyegfgvgaavssskrtwdqnntgligtgdraetytgglkydanniylaa
    qytqtynatrvgslgwankaqnfeavaqyqfdfglrpsvaylqskgknlgvvagrnydde
    dilkyvdvgatyyfnknmstyvdykinllddnqftraagintddivalglvyqf