PDB entry 2xdr

View 2xdr on RCSB PDB site
Description: crystallographic structure of betaine aldehyde dehydrogenase mutant e252a from pseudomonas aeruginosa
Class: oxidoreductase
Keywords: aldehyde oxidation, nadph complex, oxidoreductase
Deposited on 2010-05-06, released 2011-06-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-14, with a file datestamp of 2016-12-09.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: betaine aldehyde dehydrogenase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HTJ1 (0-488)
      • engineered mutation (250)
    Domains in SCOPe 2.07: d2xdra_
  • Chain 'B':
    Compound: betaine aldehyde dehydrogenase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HTJ1 (0-488)
      • engineered mutation (250)
    Domains in SCOPe 2.07: d2xdrb_
  • Chain 'C':
    Compound: betaine aldehyde dehydrogenase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HTJ1 (0-488)
      • engineered mutation (250)
    Domains in SCOPe 2.07: d2xdrc_
  • Chain 'D':
    Compound: betaine aldehyde dehydrogenase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HTJ1 (0-488)
      • engineered mutation (250)
    Domains in SCOPe 2.07: d2xdrd_
  • Heterogens: GOL, TOE, K, NDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2xdrA (A:)
    arfeeqklyiggryveassgatfetinpangevlakvqrasredveravqsavegqkvwa
    amtamqrsrilrravdilrerndelaaletldtgkplaetrsvdivtgadvleyyaglvp
    aiegeqiplretsfvytrreplgvvagigawnypvqialwksapalaagnamifkpsevt
    pltalklaeiyteagvpdgvfnvltgsgrevgqwltehpliekisftggtstgkkvmasa
    sssslkevtmalggkspliifpdadldraadiavmanffssgqvctngtrvfihrsqqar
    feakvlervqrirlgdpqdentnfgplvsfphmesvlgyiesgkaqkarllcggervtdg
    afgkgayvaptvftdcrddmtivreeifgpvmsilvyddedeairrandteyglaagvvt
    qdlarahraihrleagicwintwgespaempvggykqsgvgrenglttlahytriksvqv
    elgdyasvf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2xdrB (B:)
    arfeeqklyiggryveassgatfetinpangevlakvqrasredveravqsavegqkvwa
    amtamqrsrilrravdilrerndelaaletldtgkplaetrsvdivtgadvleyyaglvp
    aiegeqiplretsfvytrreplgvvagigawnypvqialwksapalaagnamifkpsevt
    pltalklaeiyteagvpdgvfnvltgsgrevgqwltehpliekisftggtstgkkvmasa
    sssslkevtmalggkspliifpdadldraadiavmanffssgqvctngtrvfihrsqqar
    feakvlervqrirlgdpqdentnfgplvsfphmesvlgyiesgkaqkarllcggervtdg
    afgkgayvaptvftdcrddmtivreeifgpvmsilvyddedeairrandteyglaagvvt
    qdlarahraihrleagicwintwgespaempvggykqsgvgrenglttlahytriksvqv
    elgdyasvf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2xdrC (C:)
    arfeeqklyiggryveassgatfetinpangevlakvqrasredveravqsavegqkvwa
    amtamqrsrilrravdilrerndelaaletldtgkplaetrsvdivtgadvleyyaglvp
    aiegeqiplretsfvytrreplgvvagigawnypvqialwksapalaagnamifkpsevt
    pltalklaeiyteagvpdgvfnvltgsgrevgqwltehpliekisftggtstgkkvmasa
    sssslkevtmalggkspliifpdadldraadiavmanffssgqvctngtrvfihrsqqar
    feakvlervqrirlgdpqdentnfgplvsfphmesvlgyiesgkaqkarllcggervtdg
    afgkgayvaptvftdcrddmtivreeifgpvmsilvyddedeairrandteyglaagvvt
    qdlarahraihrleagicwintwgespaempvggykqsgvgrenglttlahytriksvqv
    elgdyasvf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2xdrD (D:)
    arfeeqklyiggryveassgatfetinpangevlakvqrasredveravqsavegqkvwa
    amtamqrsrilrravdilrerndelaaletldtgkplaetrsvdivtgadvleyyaglvp
    aiegeqiplretsfvytrreplgvvagigawnypvqialwksapalaagnamifkpsevt
    pltalklaeiyteagvpdgvfnvltgsgrevgqwltehpliekisftggtstgkkvmasa
    sssslkevtmalggkspliifpdadldraadiavmanffssgqvctngtrvfihrsqqar
    feakvlervqrirlgdpqdentnfgplvsfphmesvlgyiesgkaqkarllcggervtdg
    afgkgayvaptvftdcrddmtivreeifgpvmsilvyddedeairrandteyglaagvvt
    qdlarahraihrleagicwintwgespaempvggykqsgvgrenglttlahytriksvqv
    elgdyasvf