PDB entry 2xdi

View 2xdi on RCSB PDB site
Description: Tryptophan repressor with L75F mutation in its apo form (no L- tryptophan bound)
Class: transcription
Keywords: apo-l75f-trpr, l-trp binding, transcription
Deposited on 2010-05-03, released 2010-07-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trp operon repressor
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A882 (Start-106)
      • engineered mutation (73)
    Domains in SCOPe 2.06: d2xdia_
  • Chain 'B':
    Compound: trp operon repressor
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A882 (Start-106)
      • engineered mutation (73)
    Domains in SCOPe 2.06: d2xdib_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xdiA (A:)
    aqqspysaamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvriveel
    lrgemsqrelknefgagiatitrgsnslkaapvelrqwleevllksd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xdiA (A:)
    qspysaamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvriveellr
    gemsqrelknefgagiatitrgsnslkaapvelrqwleevllksd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2xdiB (B:)
    aqqspysaamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvriveel
    lrgemsqrelknefgagiatitrgsnslkaapvelrqwleevllksd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xdiB (B:)
    qspysaamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvriveellr
    gemsqrelknefgagiatitrgsnslkaapvelrqwleevllksd