PDB entry 2xcz

View 2xcz on RCSB PDB site
Description: Crystal Structure of macrophage migration inhibitory factor homologue from Prochlorococcus marinus
Class: immune system
Keywords: cytokine, tautomerase, immune system, cyanobacterium
Deposited on 2010-04-27, released 2010-09-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-02-06, with a file datestamp of 2019-02-01.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: possible atls1-like light-inducible protein
    Species: PROCHLOROCOCCUS MARINUS [TaxId:74547]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2xcza_
  • Heterogens: PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xczA (A:)
    mpliniqasvpavadansllqelssklaellgkpekyvmtslqcgvpmtfsgnteptcyv
    evksigaldgsrtqevselvcghieqnlgipadriyigfedvparlwgwngstfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xczA (A:)
    pliniqasvpavadansllqelssklaellgkpekyvmtslqcgvpmtfsgnteptcyve
    vksigaldgsrtqevselvcghieqnlgipadriyigfedvparlwgwngstfg