PDB entry 2xbf

View 2xbf on RCSB PDB site
Description: nedd4 hect structure
Class: ligase
Keywords: ligase
Deposited on 2010-04-09, released 2011-03-23
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-04-13, with a file datestamp of 2011-04-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.1997
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase NEDD4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2xbfa_
  • Heterogens: EDO, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xbfA (A:)
    gplgsrdykrkyeffrrklkkqndipnkfemklrratvledsyrrimgvkradflkarlw
    iefdgekgldyggvarewffliskemfnpyyglfeysatdnytlqinpnsglcnedhlsy
    fkfigrvagmavyhgklldgffirpfykmmlhkpitlhdmesvdseyynslrwilendpt
    eldlrfiideelfgqthqhelknggseivvtnknkkeyiylviqwrfvnriqkqmaafke
    gffelipqdlikifdenelellmcglgdvdvndwrehtkykngysanhqviqwfwkavlm
    mdsekrirllqfvtgtsrvpmngfaelygsngpqsftveqwgtpeklprahtcfnrldlp
    pyesfeelwdklqmaientqgfdgvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xbfA (A:)
    srdykrkyeffrrklkkqndipnkfemklrratvledsyrrimgvkradflkarlwiefd
    gekgldyggvarewffliskemfnpyyglfeysatdnytlqinpnsglcnedhlsyfkfi
    grvagmavyhgklldgffirpfykmmlhkpitlhdmesvdseyynslrwilendpteldl
    rfiideelfgqthqhelknggseivvtnknkkeyiylviqwrfvnriqkqmaafkegffe
    lipqdlikifdenelellmcglgdvdvndwrehtkykngysanhqviqwfwkavlmmdse
    krirllqfvtgtsrvpmngfaelygsngpqsftveqwgtpeklprahtcfnrldlppyes
    feelwdklqmaient