PDB entry 2xb5

View 2xb5 on RCSB PDB site
Description: tet repressor (class d) in complex with 7-iodotetracycline
Class: transcription
Keywords: transcription, antibiotic resistance, metal-binding, transcription regulation
Deposited on 2010-04-05, released 2010-10-06
The last revision prior to the SCOPe 2.03 freeze date was dated 2010-10-06, with a file datestamp of 2010-10-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.16847
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: tetracycline repressor protein class d
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0ACT4 (0-206)
  Domains in SCOPe 2.03: d2xb5a1, d2xb5a2
• Heterogens: I7T, MG, CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2xb5A (A:)
  arlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
  rhhdyslpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmt
  engfslrdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsdd
  geqaflhgleslirgfevqltallqiv