PDB entry 2xau

View 2xau on RCSB PDB site
Description: Crystal structure of the Prp43p DEAH-box RNA helicase in complex with ADP
Class: hydrolase
Keywords: hydrolase, ribosome biogenesis, ATPase, ATP-binding, ob-fold
Deposited on 2010-03-31, released 2010-06-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-06, with a file datestamp of 2019-02-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.1857
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP43
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2xaua1, d2xaua2, d2xaua3, d2xaua4, d2xaua5
  • Chain 'B':
    Compound: Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP43
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2xaub1, d2xaub2, d2xaub3, d2xaub4, d2xaub5
  • Heterogens: ADP, MG, NI, ACT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xauA (A:)
    mgskrrfssehpdpvetsipeqaaeiaeelskqhplpseeplvhhdagefkglqrhhtsa
    eeaqkledgkinpftgreftpkyvdilkirrelpvhaqrdeflklyqnnqimvfvgetgs
    gkttqipqfvlfdemphlentqvactqprrvaamsvaqrvaeemdvklgeevgysirfen
    ktsnktilkymtdgmllreamedhdlsrysciildeahertlatdilmgllkqvvkrrpd
    lkiiimsatldaekfqryfndapllavpgrtypvelyytpefqrdyldsairtvlqihat
    eeagdillfltgedeiedavrkislegdqlvreegcgplsvyplygslpphqqqrifepa
    peshngrpgrkvvistniaetsltidgivyvvdpgfskqkvynprirvesllvspiskas
    aqqragragrtrpgkcfrlyteeafqkelieqsypeilrsnlsstvlelkklgiddlvhf
    dfmdppapetmmraleelnylaclddegnltplgrlasqfpldpmlavmligsfefqcsq
    eiltivamlsvpnvfirptkdkkraddaknifahpdgdhitllnvyhafksdeayeygih
    kwcrdhylnyrslsaadnirsqlerlmnrynlelnttdyespkyfdnirkalasgffmqv
    akkrsgakgyitvkdnqdvlihpstvlghdaewviynefvltsknyirtvtsvrpewlie
    iapayydlsnfqkgdvklslerikekvdrlnelkqgknkkkskhskkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xauA (A:)
    skrrfssehpdpvetsipeqaaeiaeelskqhplpseeplvhhdagefkglqrhhtsaee
    aqkledgkinpftgreftpkyvdilkirrelpvhaqrdeflklyqnnqimvfvgetgsgk
    ttqipqfvlfdemphlentqvactqprrvaamsvaqrvaeemdvklgeevgysirfenkt
    snktilkymtdgmllreamedhdlsrysciildeahertlatdilmgllkqvvkrrpdlk
    iiimsatldaekfqryfndapllavpgrtypvelyytpefqrdyldsairtvlqihatee
    agdillfltgedeiedavrkislegdqlvreegcgplsvyplygslpphqqqrifepape
    shngrpgrkvvistniaetsltidgivyvvdpgfskqkvynprirvesllvspiskasaq
    qragragrtrpgkcfrlyteeafqkelieqsypeilrsnlsstvlelkklgiddlvhfdf
    mdppapetmmraleelnylaclddegnltplgrlasqfpldpmlavmligsfefqcsqei
    ltivamlsvpnvfirptkdkkraddaknifahpdgdhitllnvyhafksdeayeygihkw
    crdhylnyrslsaadnirsqlerlmnrynlelnttdyespkyfdnirkalasgffmqvak
    krsggyitvkdnqdvlihpstvlghdaewviynefvltsknyirtvtsvrpewlieiapa
    yydlsnfqkgdvklslerikekvdr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2xauB (B:)
    mgskrrfssehpdpvetsipeqaaeiaeelskqhplpseeplvhhdagefkglqrhhtsa
    eeaqkledgkinpftgreftpkyvdilkirrelpvhaqrdeflklyqnnqimvfvgetgs
    gkttqipqfvlfdemphlentqvactqprrvaamsvaqrvaeemdvklgeevgysirfen
    ktsnktilkymtdgmllreamedhdlsrysciildeahertlatdilmgllkqvvkrrpd
    lkiiimsatldaekfqryfndapllavpgrtypvelyytpefqrdyldsairtvlqihat
    eeagdillfltgedeiedavrkislegdqlvreegcgplsvyplygslpphqqqrifepa
    peshngrpgrkvvistniaetsltidgivyvvdpgfskqkvynprirvesllvspiskas
    aqqragragrtrpgkcfrlyteeafqkelieqsypeilrsnlsstvlelkklgiddlvhf
    dfmdppapetmmraleelnylaclddegnltplgrlasqfpldpmlavmligsfefqcsq
    eiltivamlsvpnvfirptkdkkraddaknifahpdgdhitllnvyhafksdeayeygih
    kwcrdhylnyrslsaadnirsqlerlmnrynlelnttdyespkyfdnirkalasgffmqv
    akkrsgakgyitvkdnqdvlihpstvlghdaewviynefvltsknyirtvtsvrpewlie
    iapayydlsnfqkgdvklslerikekvdrlnelkqgknkkkskhskkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xauB (B:)
    skrrfssehpdpvetsipeqaaeiaeelskqhplpseeplvhhdagefkglqrhhtsaee
    aqkledgkinpftgreftpkyvdilkirrelpvhaqrdeflklyqnnqimvfvgetgsgk
    ttqipqfvlfdemphlentqvactqprrvaamsvaqrvaeemdvklgeevgysirfenkt
    snktilkymtdgmllreamedhdlsrysciildeahertlatdilmgllkqvvkrrpdlk
    iiimsatldaekfqryfndapllavpgrtypvelyytpefqrdyldsairtvlqihatee
    agdillfltgedeiedavrkislegdqlvreegcgplsvyplygslpphqqqrifepape
    shngrpgrkvvistniaetsltidgivyvvdpgfskqkvynprirvesllvspiskasaq
    qragragrtrpgkcfrlyteeafqkelieqsypeilrsnlsstvlelkklgiddlvhfdf
    mdppapetmmraleelnylaclddegnltplgrlasqfpldpmlavmligsfefqcsqei
    ltivamlsvpnvfirptkdkkraddaknifahpdgdhitllnvyhafksdeayeygihkw
    crdhylnyrslsaadnirsqlerlmnrynlelnttdyespkyfdnirkalasgffmqvak
    krgyitvkdnqdvlihpstvlghdaewviynefvltsknyirtvtsvrpewlieiapayy
    dlsnfqkgdvklslerikekv