PDB entry 2xat

View 2xat on RCSB PDB site
Description: complex of the hexapeptide xenobiotic acetyltransferase with chloramphenicol and desulfo-coenzyme a
Class: acetyltransferase
Keywords: acetyltransferase, xenobiotic, chloramphenicol, left-handed beta helix
Deposited on 1998-03-11, released 1998-06-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.213
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xenobiotic acetyltransferase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26841
      • conflict (96)
      • conflict (115)
      • conflict (202)
    Domains in SCOPe 2.07: d2xata_
  • Heterogens: CLM, DCA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xatA (A:)
    mgnyfespfrgkllseqvsnpnirvgrysyysgyyhghsfddcarylmpdrddvdklvig
    sfcsigsgaafimagnqghraewastfpfhfmheepafagavngyqpagdtlighevwig
    teamfmpgvrvghgaiigsralvtgdvepyaivggnpartirkrfsdgdiqnllemawwd
    wpladieaampllctgdipalyqhwkqrqata
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xatA (A:)
    nyfespfrgkllseqvsnpnirvgrysyysgyyhghsfddcarylmpdrddvdklvigsf
    csigsgaafimagnqghraewastfpfhfmheepafagavngyqpagdtlighevwigte
    amfmpgvrvghgaiigsralvtgdvepyaivggnpartirkrfsdgdiqnllemawwdwp
    ladieaampllctgdipalyqhwkqrqa