PDB entry 2xai

View 2xai on RCSB PDB site
Description: Crystal structure of ankyrin repeat and SOCS box-containing protein 9 (ASB9) in complex with elonginB and elonginC
Class: transcription
Keywords: transcription, transcription regulation, autoantibody
Deposited on 2010-03-31, released 2010-04-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-01-30, with a file datestamp of 2013-01-25.
Experiment type: XRAY
Resolution: 2.58 Å
R-factor: 0.2376
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ankyrin repeat and socs box protein 9
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q96DX5 (Start-260)
• Chain 'B':
  Compound: Transcription elongation factor B polypeptide 1
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q15369 (Start-95)
  Domains in SCOPe 2.06: d2xaib_
• Chain 'C':
  Compound: Transcription elongation factor B polypeptide 2
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q15370
• Chain 'D':
  Compound: ankyrin repeat and socs box protein 9
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q96DX5 (Start-260)
• Chain 'E':
  Compound: Transcription elongation factor B polypeptide 1
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q15369 (Start-95)
  Domains in SCOPe 2.06: d2xaie_
• Chain 'F':
  Compound: Transcription elongation factor B polypeptide 2
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q15370
  Domains in SCOPe 2.06: d2xaif_
• Heterogens: EDO, CL, PEG, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >2xaiB (B:)
  myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
  ftykvrytnssteipefpiapeialellmaanfldc
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2xaiB (B:)
  yvklissdghefivkrehaltsgtikamlnevnfreipshvlskvcmyftykvrytnsei
  pefpiapeialellmaanfldc
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  Sequence, based on SEQRES records: (download)
  

  >2xaiE (E:)
  myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
  ftykvrytnssteipefpiapeialellmaanfldc
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2xaiE (E:)
  yvklissdghefivkrehaltsgtikamlevnfreipshvlskvcmyftykvrytnseip
  efpiapeialellmaanfldc
  

  
  
• Chain 'F':
  Sequence, based on SEQRES records: (download)
  

  >2xaiF (F:)
  mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
  gftsqtarpqapatvglafraddtfealciepfssppelpdvmkpqdsgssaneqavq
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2xaiF (F:)
  dvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgecg
  ftsqtarpqapatvglafraddtfealciepfssppelpdvmkpq