PDB entry 2xa8

View 2xa8 on RCSB PDB site
Description: Crystal structure of the Fab domain of omalizumab at 2.41A
Class: immune system
Keywords: xolair, allergy, immune system
Deposited on 2010-03-30, released 2011-05-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-01-27, with a file datestamp of 2016-01-22.
Experiment type: XRAY
Resolution: 2.42 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: omalizumab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2XA8 (0-218)
  • Chain 'L':
    Compound: omalizumab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2XA8 (0-217)
    Domains in SCOPe 2.07: d2xa8l1, d2xa8l2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2xa8L (L:)
    diqltqspsslsasvgdrvtitcrasqsvdydgdsymnwyqqkpgkapklliyaasyles
    gvpsrfsgsgsgtdftltisslqpedfatyycqqshedpytfgqgtkveikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnrgec