PDB entry 2x8r

View 2x8r on RCSB PDB site
Description: The structure of a family GH25 lysozyme from Aspergillus fumigatus
Class: hydrolase
Keywords: peptidoglycan cleavage, endo-n-acetylmuramidases, hydrolase, dxe motif
Deposited on 2010-03-11, released 2010-09-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-04-18, with a file datestamp of 2012-04-13.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.17094
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycosyl hydrolase
    Species: ASPERGILLUS FUMIGATUS [TaxId:330879]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2x8ra_
  • Chain 'B':
    Compound: glycosyl hydrolase
    Species: ASPERGILLUS FUMIGATUS [TaxId:330879]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2x8rb_
  • Chain 'C':
    Compound: glycosyl hydrolase
    Species: ASPERGILLUS FUMIGATUS [TaxId:330879]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2x8rc_
  • Chain 'D':
    Compound: glycosyl hydrolase
    Species: ASPERGILLUS FUMIGATUS [TaxId:330879]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2x8rd_
  • Chain 'E':
    Compound: glycosyl hydrolase
    Species: ASPERGILLUS FUMIGATUS [TaxId:330879]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2x8re_
  • Chain 'F':
    Compound: glycosyl hydrolase
    Species: ASPERGILLUS FUMIGATUS [TaxId:330879]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2x8rf_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2x8rA (A:)
    attvqgfdisnhqksvnfeaakkdgaqfvmikategttykdtvfnshytgatkagllrgg
    yhfarpdkstgstqakfflkngggwsddnrtlpgmldieynpygatcyglshsqmvawih
    dfvneyhhatsrwpmiyttadwwnrctgnakgfgdkcplvlaaysssppktipgdwktwt
    iwqnsdkykhggdsdkfngpmtqlrklasg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x8rA (A:)
    ttvqgfdisnhqksvnfeaakkdgaqfvmikategttykdtvfnshytgatkagllrggy
    hfarpdkstgstqakfflkngggwsddnrtlpgmldieynpygatcyglshsqmvawihd
    fvneyhhatsrwpmiyttadwwnrctgnakgfgdkcplvlaaysssppktipgdwktwti
    wqnsdkykhggdsdkfngpmtqlrklasg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2x8rB (B:)
    attvqgfdisnhqksvnfeaakkdgaqfvmikategttykdtvfnshytgatkagllrgg
    yhfarpdkstgstqakfflkngggwsddnrtlpgmldieynpygatcyglshsqmvawih
    dfvneyhhatsrwpmiyttadwwnrctgnakgfgdkcplvlaaysssppktipgdwktwt
    iwqnsdkykhggdsdkfngpmtqlrklasg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2x8rC (C:)
    attvqgfdisnhqksvnfeaakkdgaqfvmikategttykdtvfnshytgatkagllrgg
    yhfarpdkstgstqakfflkngggwsddnrtlpgmldieynpygatcyglshsqmvawih
    dfvneyhhatsrwpmiyttadwwnrctgnakgfgdkcplvlaaysssppktipgdwktwt
    iwqnsdkykhggdsdkfngpmtqlrklasg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2x8rD (D:)
    attvqgfdisnhqksvnfeaakkdgaqfvmikategttykdtvfnshytgatkagllrgg
    yhfarpdkstgstqakfflkngggwsddnrtlpgmldieynpygatcyglshsqmvawih
    dfvneyhhatsrwpmiyttadwwnrctgnakgfgdkcplvlaaysssppktipgdwktwt
    iwqnsdkykhggdsdkfngpmtqlrklasg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x8rD (D:)
    ttvqgfdisnhqksvnfeaakkdgaqfvmikategttykdtvfnshytgatkagllrggy
    hfarpdkstgstqakfflkngggwsddnrtlpgmldieynpygatcyglshsqmvawihd
    fvneyhhatsrwpmiyttadwwnrctgnakgfgdkcplvlaaysssppktipgdwktwti
    wqnsdkykhggdsdkfngpmtqlrklasg
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2x8rE (E:)
    attvqgfdisnhqksvnfeaakkdgaqfvmikategttykdtvfnshytgatkagllrgg
    yhfarpdkstgstqakfflkngggwsddnrtlpgmldieynpygatcyglshsqmvawih
    dfvneyhhatsrwpmiyttadwwnrctgnakgfgdkcplvlaaysssppktipgdwktwt
    iwqnsdkykhggdsdkfngpmtqlrklasg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2x8rF (F:)
    attvqgfdisnhqksvnfeaakkdgaqfvmikategttykdtvfnshytgatkagllrgg
    yhfarpdkstgstqakfflkngggwsddnrtlpgmldieynpygatcyglshsqmvawih
    dfvneyhhatsrwpmiyttadwwnrctgnakgfgdkcplvlaaysssppktipgdwktwt
    iwqnsdkykhggdsdkfngpmtqlrklasg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x8rF (F:)
    ttvqgfdisnhqksvnfeaakkdgaqfvmikategttykdtvfnshytgatkagllrggy
    hfarpdkstgstqakfflkngggwsddnrtlpgmldieynpygatcyglshsqmvawihd
    fvneyhhatsrwpmiyttadwwnrctgnakgfgdkcplvlaaysssppktipgdwktwti
    wqnsdkykhggdsdkfngpmtqlrklasg