PDB entry 2x8l

View 2x8l on RCSB PDB site
Description: plasmodium falciparum lactate dehydrogenase apo structure
Class: oxidoreductase
Keywords: nad, pyruvate, glycolysis, oxidoreductase
Deposited on 2010-03-10, released 2010-03-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-06-02.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.13726
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-lactate dehydrogenase
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q27743 (Start-315)
      • expression tag (316-320)
    Domains in SCOPe 2.06: d2x8la1, d2x8la2, d2x8la3
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2x8lA (A:)
    mapkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnck
    vsgsntyddlagadvvivtagftkapgksdkewnrddllplnnkimieigghikkncpna
    fiivvtnpvdvmvqllhqhsgvpknkiiglggvldtsrlkyyisqklnvcprdvnahivg
    ahgnkmvllkryitvggiplqefinnklisdaeleaifdrtvntaleivnlhaspyvapa
    aaiiemaesylkdlkkvlicstllegqyghsdifggtpvvlgangveqvielqlnseeka
    kfdeaiaetkrmkalahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x8lA (A:)
    apkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnckv
    sgsntyddlagadvvivtagftknrddllplnnkimieigghikkncpnafiivvtnpvd
    vmvqllhqhsgvpknkiiglggvldtsrlkyyisqklnvcprdvnahivgahgnkmvllk
    ryitvggiplqefinnklisdaeleaifdrtvntaleivnlhaspyvapaaaiiemaesy
    lkdlkkvlicstllegqyghsdifggtpvvlgangveqvielqlnseekakfdeaiaetk
    rmkalahhhhh